Acorn CPCPMDISCâîú~ÒÊæyëÏGreetings from Clean End - Ian Mark Neil Simon Dirty End - Dave Ian John TobyBoss Man - Howard >2.>ý끊P$TlLll##/M  0T!!P~#G˸ 2g:_^#V>!g(5!>͌>!} O!g6 yÞ..>} .>!>y&>.>0ɯ=.!!!y! >.!o>.!>}ȯ=:̀>"h>|!6( (!&l͎Printer off linèl͎SPACE starts Printer Sink ͢(ͮ .>.>l ͺ*hͺMͺLͺȯ{ ~#(ͣ ͬ> Oú͎ Not a CP/M system disc in Aͮ1ͧ2!C D:O8yO122C2D3͓͎ Acorn CP/M 2.2 - Bios 1.20 ͎!܆#7!R 2222Ϳ*">!>22!"!"C: 2y2`i!y2o)))) y2s12>22>2/s12y2 >2:2:2:2:(1=2:! $:! :! 4~86!422<22:2!~6(":! :! :!($::2:2:2:2:o&)))))))r[: >2::{2:-w>S(M:(:! :!(!:w:2I>2>->K w>22:2:P8 O:2>2:ͬ2!cͤ(S M͎ Bdos Err On :AOͺ͎: R/O (Disc is Write Protected)ͮR(r(>2O! ~rS"&S*j 2,:ͬ!% r>!r[w*rRR0[y*tR *{:vȯ2:!!rw:(  :8ɯ= F<(!͎Running BOOT.COM ! 9<,<(͎Submitting BOOT.SUB !͎BOOT.SUB present but no SUBMIT.COM BOOT SUBMIT BOOTSUBMIT COMBOOT SUBBOOT COM\X COPYRIGHT (C) 1979, DIGITAL RESEARCH _͌> ͒> Ò> Ò͘~#͌ì _2<ԯ2 Շ!۶2:2a{_:۷ʖ:۷>Ľʖ:=2–!B!6#5ʖ:۷Ľ!ͬʧ )!F#xʺ~0wëw!" !~6ͽ:ý(!#͘*~ "ַ"͌#>?͌͘ =_.:;<> Oօo$>!Y2*O"ʉ@G:ʐ:wÖx2p0ʹ#*©6?ëw˜0ï#6 ¹.0#*6?w0#6 #6" #~?  xDIR ERA TYPESAVEREN USERt !yO#< Ty#O 3ׯ21y_͸2y2ͽ:Է˜1͘A͌>>͌92^ :۷¥.!_~#fow]٭ڎڥ!v"!çREAD ERRORçNO FILE^:۷ ! ~ 3#0 Wx x ր ւ G ~ # 3x~#B!Y~ɯ2:۷=!۾ý:۷=!۾:ý^T!~  6?#ˆ:`O> K{͘A͒>:͒͢>:͒͢xK > K > ͒x  ͢ØÆ^ BRͧ9!5‚#~Y‚#"T<ÆALL (Y/N)?^ Tʧ͘!6!~ڇ ٯw4!Y~ʆ͌†t=ʆf ^ T ٯ2o&)|+!<ͧÆNO SPACE^ :Ty!B*O=?_s#"^sG!~Yڸpsp2mÆÆf ͧÆFILE EXISTS _: É: :۷ʉ=2)ͽÉ T!@k!}|q=qf^!~2>`~2ۯ2\!!B!~> >#0~O#Cx2͘1)ͽÂf zͧÆBAD LOADCOMf^: !۶ Â$$$ SUBt ܙܥܫܱ"C{2!"E9"1A߯22!ty)K!G_^#V*Cސ~E ,&-AGMSߛ!!ô!ô!Bdos Err On : $Bad Sector$Select$File R/O$:BA2!~6 O͐  :߷E B 2>: ߷b# : ߷y! 4 5~yy5 6yҐ^H@Oy H H: –ͬ  #H: ! ߾ Hù H H $O͐: 2 *CN# x: 2 p&>~+é7ݯ2 H! >w_: ! ߾5ͤNkͱ¦ͱxʊ#Nx: ߷! ߖ2 ͤ! 5™#wO~x½p Hy<< ʑ :!qMD#2E>! ^#V w#P:BO|^#V#"##"##"##"!O*!O*|!6ʝ6>*w#w*w#w'û*! J*""!N#F*^#V*~#foyx*{_zW+*yx#*DM*s#r*s#ryOxG*0MD!!N: EG>O: \S*C :qn& ^#V>O^"*}:*)=":O:页o"*C *C!ͮ~2~2ͦ:2ͮ:O:w:w |g}o*鯆# ):BO!yoxg*:BO}!N#F "*#*s#r^ ~!J! J*:o$*C~i6iw**{#zr+s{ozg**͕** ,w͜͸Ͳ!!N#F$**O!~#:A߾#~$=2Ek͌::/GyO>2!q*C"͡ʔ*JҔ^:Oyʃ?|x | s-|N-# S:2E!~Яw>T D^6k-äPYy 5*{zBK5ڋ>*Cw~#+w#w+ɯ2E22i^ *C :~w~͔͔# #  w ~>2!E5T*C!"C"C!w# F! w͌x2͢*C ~<wʃG:!ʎì 4~ʶ¬:<ʶ$ʶïZͻx>2>2ͻ:!Z2:E߷ẅ́͊Ͳ>2>2T*CGͻ:ẅ́n>2;O ^DM;}H>"*C ::ddslO s#r:E߷͊:==»y==»*Ww#*"͸*:G#š"͸:!w4!iw:Z!E~=262*C!!~~#~O~G#n,-.‹! w! yG!x͢.:E<ʄ! q!pQ:E<. ʄ$.:E<ʄi6}2ExN! ~态O>G~G!~G} *C!r#r#r ^ͥ_y#x#{s+p+q-*C ͥ!!q#p#w*:BOYG}*MD "ã:!B߾w!>2*C~=2u:B2~2wE:A*C߶w>"!""2B!"!rQQQâ~?ͦ~?rQ*"CQ-Q͜QüQrQ$Q*):B"*)*)Q;*"E:;:A2AQÓQÜQ*C}/_|/*W}_*"}o|g":ʑ*C6:ʑw:2E**E}DQ>2MOVCPM COMVGSX SYS DDFXHR8 PRLv DDFXLR8 PRL`DDFXLR7 PRL`DDOKI84 PRL` !"ASSIGN SYS#DDBBC0 PRLW$%&'()DDBBC1 PRLY*+,-./MALLARD COMJ0123456789:;<UNLIST COM =CONVERT COM>?PREPARE COM@ABCDEFGHMEMO OVLXIJKLMNOPQRSTUVREADDFS BBCW6502-Z80BBC XSTAR $$$MEMO COMdYZ[\]^_`abcdefgVERIFY BBChACTIONS DEFijMEMOHELPTXTklMERGE BBCmCONFIG COM,nopqrstuvwxRECOVER COMyz{|}~CRC COMCRCKLISTCRC COPY COMFORMAT COM VERIFY COMTERM COMBBCBASICCOMnDDT COM&STAT COM*ED COM4MEMOP COMFXSUB COMMPP OVLHCONFIG DATTSORT BBCASM COM@SUBMIT COM STAR COM SYSGEN COM PIP COM:DUMP COMLOAD COMDIP COM GENGRAF COM FORMPREPCOM,COPYRIGHT (C) DIGITAL RESEARCH, 1980 1] ʑ?ʑ! __0 r))) O @|r}r.g))å{u INVALID MEMORY SIZE$!$ʡ~/w/wʔ|g*"z|?¸>@G!>0w#w!4~:60+4~u!N#F! x, # =!v"z!w6!u#+w+wz >ZxG}o|g"|! :m c p!"xp ~#c*|!:m ʅ xä SYNCRONIZATION ERROR$ {°~#o}oҼüÅ*zZ# :m m! ~ #* DM! x  w#!N#F! D!_>0w#w1!`4~:60+4*"e@u READY FOR "SYSGEN" OR "SAVE 00 CPM00.COM"$*|  CONSTRUCTING 00k CP/M vers 2.2$ !2:2a{_:ʖ:>Ľʖ:=2–!B!6#5ʖ:Ľ!ͬʧ )!F#xʺ~0wëw!" !~6ͽ:ý(!#͘*~ ""͌#>?͌͘ =_.:;<> Oo$>!Y2*O"ʉ@G:ʐ:wÖx2p0ʹ#*©6?ëw˜0ï#6 ¹.0#*6?w0#6 #6" >ͦ!q:_  !p+q.*   !q*&!p+q*2!p+q*2!p+q*22!p+q*!p+q*!p+q*!p+q*2!p+q*#~?  xDIR ERA TYPESAVEREN USERt !yO#< Ty#O 321y_͸2y2ͽ:˜1͘A͌>>͌92^ :¥.!_~#fow]!v"!çREAD ERRORçNO FILE^: ! ~ 3#0 Wx x   G ~ # 3x~#B!Y~ɯ2:=!ý:=!:ý^T!~  6?#ˆ:`O> K{͘A͒>:͒͢>:͒͢xK > K > ͒x \X COPYRIGHT (C) 1979, DIGITAL RESEARCH _͌> ͒> Ò> Ò͘~#͌ì _2<2 ͢ØÆ^ BRͧ9!5‚#~Y‚#"T<ÆALL (Y/N)?^ Tʧ͘!6!~ڇ w4!Y~ʆ͌†t=ʆf ^ T 2o&)|+!<ͧÆNO SPACE^ :Ty!B*O=?_s#"^sG!~Ypsp2mÆÆf ͧÆFILE EXISTS _: É: :ʉ=2)ͽÉ T!@k!}|q 2E > ! ^#V w#P :B O|^#V#"##"##"##"!O *!O *|!6ʝ 6>*w#w*w#w'û *! J * ""!N#F*^#V*~#foyx *{_zW+ * yx # *DM*s#r*s#ryOxG*0MD!!N: E G>O: \ S *C  :q n& ^#V> O^ "*}:*)= ":O:o"*C  *C !ͮ ~2~2ͦ :2ͮ : O:w:w |g}o *# =qf^!~2>`~22\!!B!~> >#0~O#Cx2͘1)ͽÂf zͧÆBAD LOADCOMf^: ! Â$$$ SUBt "C {2!"E 9" 1A 22!ty)K!G_^#V*C   ~E , &-AGMS  !!ô!ô!Bdos Err On : $Bad Sector$Select$File R/O$ :B A2 ! ~6 ) :B O! yoxg*:B O }!N#F "*#*s#r^  ~!J  ! J *:o$*C ~i 6i w**{#z r+s{ozg**͕ **  , w͜ ͸ Ͳ ! !N#F$**O !~#:A #~$=2E k͌  O͐  : E  B 2 >: b # : y! 4 5~yy 5 6y Ґ ^H @Oy H  H : – ͬ   #H : !  H ù  H  H $O͐ : 2 *C N#  x : 2 p & > ~+é 7 2 H ! >w _ : ! 5ͤ N k ͱ ¦ ͱ xʊ #N x : ! 2 ͤ ! 5™ #wO ~x½  p H    y< < ʑ  : !qMD #: :/GyO>2!q*C " ͡  ʔ*J Ҕ^ :Oyʃ?|x | s-|N-# S:2E !~Яw > T   D ^ 6k -äPYy 5*{zBK5ڋ>*C w~#+w#w+ɯ2E 22 i  ^ *C :~w~͔͔# # ):B  " *)*)Q;*"E :;:A  2A QÓQÜQ*C }/_|/*W}_*"}o|g":ʑ*C 6:ʑw:2E* *E }DQ>2âîú~ÒÊæyëÏGreetings from Clean End - Ian Mark Neil Simon Dirty End - Dave Ian John TobyBoss Man - Howard >2.>ýP$TlLll##T!!P w ~>2!E 5T *C !"C  "C !w# F! w͌ x 2͢ *C  ~<wʃG:!ʎì 4~ʶ ¬:<ʶ$ ʶïZͻ   x >2>2ͻ :!Z2:E w ̈́ ͊ Ͳ  >2>2T *C G ͻ : w ̈́ n> 2;O ^ DM;}H> "*C  ::dd slO s#r:E ͊ :==»y==»*Ww# *" ͸ *:G#š" ͸ :!w4!i w: Z!E ~=26~#G˸ 2g:_^#V>!g(5!>͌>!} O!g6 yÞ..>} .>!>y&>.>0ɯ=.!!!y! >.!o>.!>}ȯ=:̀>"h>|!6( (!&l͎Printer off linèl͎SPACE starts Printer Sink ͢(ͮ .>.>l ͺ*hͺMͺLͺȯ{ ~#(ͣ ͬ> Oú͎ Not a CP/M system disc in Aͮ1 ͧ2!C D:O8yO1 22C 2*C !!~~#~O~G#n,-.‹! w! yG!x͢.:E <ʄ! q!pQ:E <. ʄ$.:E <ʄ i 6}2E x N! ~态O>G~G!~G} *C !r#r#r ^ ͥ_y#x#{s+p+q-*C  ͥ!!q#p#w*:B O Y G }*MD "ã:!B w!>2*C ~=2u:B 2~2wE:A *C w>" !""2B !" !r QQQâ~?ͦ ~?r Q *"C Q- Q͜QüQr Q$Q*2D3͓͎ Acorn CP/M 2.2 - Bios 1.20 ͎!#7!R 2222Ϳ*">!>22!"!"C: 2y2`i!y2o)))) y2s1 2>22>2/s1 2y2 >2:2:2:2:(1=2:! $:! :! 4~86!422<22:2!~6(":! :! :!($::2:2:2:2:o&)))))))r[: >2::{2:-w>S(M:(:! :!(!:w:2I>2>A DI$@ A$@$$@H! "!$$" @B$!!!DH$$"H @@BHH  !$$A"D@ "A" "BHA " !$ D B I $ !$$ H@BD D$ HI DIA!$$$ $" "$D ! $"  $AB " BDD $$D!"DI$!$BH!"IB I$"D HD" " $"! @H !BI " I  $I$I$DI$ !I$@"$"$! $I$I IT TITIT->K w>22:2:P8 O:2>2:ͬ2!cͤ(S M͎ Bdos Err On :AOͺ͎: R/O (Disc is Write Protected)ͮR(r(>2O! ~rS"&S*j 2,:ͬ!% r>!r [w *r RR0[y *t R *{ :v ȯ2:!!r w :(  :8ɯ= F<(!͎Running BOOT.COM ! 9<,<(͎Submitting BOOT.SUB !͎BOOT.SUB pre@ A  A $ II$ DBD$$HI I@"$ H$$H@A$HH$$@B $ A I@ D@$ B HI DIA!$$$ $" "$D ! $"  $AB " BDD $$D!"DI$!$BH!"IB I$"D HD" " $"! @H !BI " I  $I$I$DI$ !I$@"$"$! $I$I IT TITITsent but no SUBMIT.COM BOOT SUBMIT BOOTSUBMIT COMBOOT SUBBOOT COM$@B B HH II$@DI ABI$"$H$H@$$I! H*  $H@@A I $D!!$I"BI"I"@$BIIH$$$$BBI$@BI!"$$All Rights Reserved --------------------------------------------------- $ys! ͩ*~#fo+|ʑQ*^#V*Ͳ!~#fo<Ͳʽ ã##"! ͩ*~#fo#"#~#fo#"Î*##^#V{!K*!A"* *  ~#fo!zW{_<y O|g}o .}|#*N#F*y*u*u ^DM^#V>))}o|gҒ =‚zW{_ңs#r#w# ©}o|g=͂*Ͳ*B{z×͂!!w# yD!xw#z c*K,2͂!"KA~!ͩ!"K!56×[=^#nvA!~ʫ@_n:n#> v.n>v  too big to load$: unexpected EOF$ not found$PRL $$$I D$$H"B@$ $ HD !$$HHB! ))}o|gҒ =‚zW{_ңs#r#w# ©}o|g=͂*Ͳ*B{z×͂!!w# yDm--------------------------------------------------- GSX-80 1.1 01 Oct 83 Serial No 5000-0884-003481 Copyright (C) 1983 Digital Research, Inc. *hw#6=G>2 x͐ : *%#"%*b~͐ *b##~2͐ *f":ͪ*$"$ ͪ*$"$ =@: *%#"%*b~͐ *b##~͐ *f"ͪ:o o&͖ *$"$ͪ:o o&͖ *$"$=‰: *b~.2*%#"%*b~͐ :͐ !""*e "*k *&"*m :g OڀK "*e K "*>Ñh"*e K "*>ÑK K "*e "*>ÑK "*e "*> ""2͐ *f"ͪ**$"$*$"$ ͪ*|!*$"$*$"$ **$"$*$"$33EPSON1.1 HR8 01 Oct 83Serial No 5000-0884-003481!b Ͱ *b~"l6#6"a!no>g^#Va e5:aa3aAOvaaaaaaa*b ~=*h6#6#6#6*%#"%> ͐ *f##F#~x`>`>2m 2e ͐ :**$"$*$"$*d":ͪ{͐ =!: *%#"%!""!""*b~͐ *b##~2/͐ *f"24:/ͪ:4ƒbk"0*$"$*"*;" ͪ:4´<24bk"2*$"$*"*;" =s*0 *2 * * * * *b ~=%: > ͐ >͐ >;: > ͐ >͐ >͐ >2r*%#"%*f"!L"t>ͪ*$"$ ͪ*$"$ =S*L\U!Tr#sT! r#s! r#s! r#s*N\U! r#s! r#s! r#s! r#s*P\U! r#s! r#s! r#s*R\U! r#s! r#s! r#s!T"t*t~#"t͐ e G:m 2k *j:e G:k w#6#:m w#6# *j:k w*l6*%#"%> ͐ *d^#V!}քo|ga R>2g ͐ ! ^#V*hs#r *%#"%>͐ *d~ڣڥ>*hw#6=͐ ͫ2 >*%#"%>͐ *d~>*hw#6=2w ͐ *%#"%>͐ *f##F#~x` >`>2o 2i ͐ *j6#6#:o w#6*l6ͫ2 >ͫ2 >*%#"%>͐ *d~ik>*hw#6͐ *%#"%>͐ *d~ڐڒ>*hw#6͐ ͫ2 >*d~ڶ>*hw#62: <͐ :͐ *%#"%*%#"%> ͐ *d~>:r=2r*tr#s#"t>2v!xGyO5|g}ozW{_:v=2v%33yVÎx/Gy/O>=gÍ)ځ)r, {_33_)҈, _$%K {ozgz{z?z?{zz{͝bk͝bk|!͝bk}o|g|DM!x y )   |K |K R z, ^ x)yOxGyxD GyO#=0 ogeo, , )g #_ OI  `iůK !zW{_ғ y O|g}o … ҡ #͏`i͏DM>))}o|g =¶ (*%| ͻ ͖!"%"$"$ 7?`  " *m +*o|!"{I* : 8*m"m2 *o"o>2 *o"s*m"q* >F:H>xm:H: ҅È=q=e: ҫ*o"sô*m"q=`=#Z*q:#+"q*s:#+"s*m|* ͸*o x2*{ x2:7: 2 : 2 ( 2>2 :i 2H2o :w o& " >22= "m`i"o*o +*m* ͸Ғ*o +*o"{I[K:%G*$"#*%"#|!"#͍m*#+|x *#"%à._c ! <Ͱ :& ``0*D" *F" *H" *J" *dq Ͱ !s 5!w 5>2e 2i 2c 2g 2 2 2 2 2 2 2 2 2 2 2 =2 2 2 2 2 2 2 2 >2m 2o ==2k !c  <Ͱ 2& !"$"$!"$"*l66-#6*h! ZͰ *j!K Ͱ ~# x° :& ) ¼ !"") !„ !)"!"!&   *%+|2( !)o>g^#V!.2N  2>?^el2222222: 2 : 2 ( *^#V#"( 2e G2m 2k ( 2g ( 2s !_^#V" 0( 2u <2 / : 2 : 2 ( 2w ( 2i ( 2y 1<2 /:: 2 : 2 ( 2} Q<2 /Z: 2 : 2 ( 2 ( 2 ( 2 ~<2 /Ç: 2 : 2 ( 2 ›2 çG>2 xҰ>2 Ҿ=2 >>2 /2 2 2 2 2 2 : 2 2 2 2 2 ɯ2#:u 2$: 2u :s 2$~ 6 *:&L ) ͸L **"͸i *F#! ͸c *#"!) "x"") !„ I  7 *w#" ͸ʣ !) "x 7 :&!(Ͱ <2&ü z͐ ' {͐ ' ( W( _( G( O*"! ͖M |= ! *#"!) "*$#" : 2 : 2 ( ( 2 :e 2H "m`i"o" : ک : >” >2: >£ >2 : >µ >2: > >2=G( eo& " *k : K " *m K #( 2$<*"$*"$o&))  "$"#`i"$ "$"#`i"$*"$*"$*$*#͸ژ*#*$͸ژ: i* "$: 2 : 2 !: 2s =ʔ* ʑ4"$*#"$*#"$*$͸Ҵ"$*$*$͸"$*$"$͖#"$:#>2$2$:$2$*$"*$" "$`i"$ "$PY*$"$͖"$2$*$*$͖G:$ʾ*$*$͖"$|ʾ*$*$͖GZK "$*$|kGK DM*$*$|ʅGK DM)}o|gNzW{_xʨK *$*$#"$+)# s#r:$=2$*$"$*$"$:$Xͫ:$<2$!#^#V#N#F#`i͸M"y"m"o*#͸*#͸DM*##1*#͖"*}*| !xUgPY*BKͤ *x z>4uu2#*|?͏K ڷ :#ʷ*}|ʷ|*÷*$͸PY*q|* ͸*s *s*q*"x2%>2%|g}o *#͖*$: .O: yGCHHw* *$͸\"$|g}o^#"$"$ >o͸ڌ!*$|ʫ|! #͸ڱ!"$"$͸ҽ"%"# y#"%*$" %%*$K "$" %*%#"%*$"u"m"q}2$*$"s"o"{"w}o&*$~2$:$O:$> 9go" "2:$=2$*$#"$:$=2$: 2 : 2 2s *$"*$":$<*$"*$":$2u :$2s *$" =2$>2$!#"$*$^#V#~#fo͸*$s#r#s#r+*$##"$:$<2$G:$Һ=2$¯( =<2#:s 22s ͗:2s  "q"m`i"s"o=k "y"u`i"{"w* "ͅ*u"q"m*w"s"o2::*oë*$*o͖ë::*më*$*m͖}O*ʿ)һ# ¶"*)#": G:u >72 /2 2 =2 "%*$"%>>L: %: %> >>2>>3>> > > >>3>> !!%6#zt2%*$)"*%)͖">2* %DM*%:%»*%"*" %*$+|BK+|* DMí:=2S*9>2*"!,xG,%_~* /->ɿWDisk Write Error, Temporary File : GSXTMP. $Disk Read Error, Temporary File : GSXTMP. $GSXTMP $$$͡*o*m:s "!"%l5*:G*:Y*m*͸r*oMr*oM*͸r*m*m*y͸–*o*{͸–*"x2%*y*m2"}͏"*{*o2"͏"*͸|g}o>zW{_2"͖DM͝> x >`i:L&#>2G2+44>"m*K DM* "͏:ʀ]#>_+"o*$K *}K *"͏2*o x2*{ x2::*y*m͖"}*{*o͖":G2x*{*y$"y"{:G>>2x*o*m$GSXTMP $$$                             888>T8|8T|DDD|D((D        DA $"H B@! BA"HI$I DH"I"I"I$A""$$HIH$!! I!HI D"@ $$ JI$ B$I I$HHHH"DDD "I$II$I $HHIHDI$$$$H$D$B$D$I A @$@I"DH$H"DHII$BH!""AHD"BI$I"$I"I$ $BA" $I"HI$ !$DI"HD$DH B @DB"!DA$D$"D!"$ D$AAB@@DHDDIID@$""I$@ !$$HI$!!AB $$ !"I$$   @@ B$$B  """"DDUUUU  HUUUUUUUUD! @D$"H  !D$AID$H! DDBI !$II$ I IBI$I"$DDB"I!"I!$$BI$I $II$A$H$"D$I$"I$BD$H B$I$BBI "D $" @ @!D" "$$II$ I$I$$HHIH$@HDH$@@H$H$H$ !$! )3Epson1.1 LR8 01 Oct 83Serial No 5000-0884-003481!b Ͱ *b~"l6#6"a!no>g^#Va e5:aa3aAOvaaaaaaa*b ~=*h6#6#6#6*$#"$> ͐ *f##F#~x`>`>2m 2e ͐ :e G:m 2k *j:e G:k w#6#:m w#6# *j:k w*l6*$#"$> ͐ *d^#V!}քo|ga R>2g ͐ ! ^#V*hs#r *$#"$>͐ *d~ڣڥ>*hw#6=͐ ͫ2 >*$#"$>͐ *d~>*hw#6=2w ͐ *$#"$>͐ *f##F#~x` >`>2o 2i ͐ *j6#6#:o w#6*l6ͫ2 >ͫ2 >*$#"$>͐ *d~ik>*hw#6͐ *$#"$>͐ *d~ڐڒ>*hw#6͐ ͫ2 >*d~ڶ>*hw#62: <͐ :͐ *$#"$*$#"$> ͐ *d~>*hw#6=G>2 x͐ : *$#"$*b~͐ *b##~2͐ *f":ͪ*{$"{$ ͪ*}$"}$ =@: *$#"$*b~͐ *b##~͐ *f"ͪ:o o&͖ *{$"{$ͪ:o o&͖ *}$"}$=‰: *b~.2*$#"$*b~͐ :͐ !""*e "*k *&"*m :g OڀK "*e K "*>Ñh"*e K "*>ÑK K "*e "*>ÑK "*e "*> ""2͐ *f"ͪ**{$"{$*$"$ ͪ*|!*}$"}$*$"$ **}$"}$*$"$ ``0*" *" *" *" *dq Ͱ !s 5!w 5>2e 2i 2c 2g 2 2 2 2 2 2 2 2 2 2 2 =2 2 2 2 2 2 2 2 >2m 2o ==2k !c  <Ͱ 2 !"{$"}$!"$"*l66-#6*h! ZͰ *j!K Ͱ ~# x° : ¼ !"!„ !"`!"b!**{$"{$*$"$*d":ͪ{͐ =!: *$#"$!""!""*b~͐ *b##~2/͐ *f"24:/ͪ:4ƒbk"0*{$"{$*"*;" ͪ:4´<24bk"2*}$"}$*"*;" =s*0 *2 * * * * *b ~=%: > ͐ >͐ >;: > ͐ >͐ >͐ >2*$#"$*f"!">ͪ*{$"{$ ͪ*}$"}$ =S*\U!r#s! r#s! r#s! r#s*\U! r#s! r#s! r#s! r#s*\U! r#s! r#s! r#s*\U! r#s! r#s! r#s!"*~#"͐ ~ 6 *`:L ͸L *b*͸i *`F#!4 ͸c *b#"b!"`x"!„ I 0 7 *`w#"`4 ͸ʣ !"` 7 :!d(Ͱ <2ü z͐ ' {͐ ' ( W( _( G( O*`"`!4 ͖M |= ! *b#"b! "`*{$#"> : 2 : 2 ( ( 24 :e 2H "m`i"o"< :4 ک :4 >” >2:4 >£ >2 :4 >µ >2:4 > >2=G( eo&@ "6 *k :4 K ": *m K #:=2*r#s#">2!xGyO5|g}ozW{_:=2%33yVÎx/Gy/O>=gÍ)ځ)r, {_33_)҈, _$%K {ozgz{z?z?{zz{͝bk͝bk|!͝bk}o|g|DM!x y )   |K |K R z, ^ x)yOxGyxD GyO#=0 ogeo, , )g #_ OI  `iůK !zW{_ғ y O|g}o … ҡ #͏`i͏DM>))}o|g =¶ 6*$| ͻ ͖!"$"{$"}$ 7?`  ": *m +*o|!"{I*: :4 8*m"m25 *o"o>25 *o"s*m"q*6 >F:H>xm:H:4 ҅È=q=e:4 ҫ*o"sô*m"q=`=#Z*q:#+"q*s:#+"s*m|*> ͸*o x2*{ x2:7: 2 : 2 ( 2>24 :i 2H2o :w o&@ "6 >22= "m`i"o*o +*m* ͸Ғ*o +*o"{I[K:$G*}$"h#*$"l#|!"j#gR*j#+|x *o#"$à<_c ! <Ͱ :"u"m"q}2s$*S$"s"o"{"w}o&*k$~2q$:s$O:q$> 9go" "2:i$=2i$*S$#"S$:E$=2E$: 2 : 2 2s *G$"`*K$"b:;$<*I$"`*M$"b:Q$2u :z$2s *O$" =2c$>2e$!q#"u$*u$^#V#~#fo͸*u$s#r#s#r+*u$##"u$:e$<2e$G:c$Һ=2c$¯( =<2n#:s 22s ͗:2s  "q"m`i"s"o=k "y"u`i"{"w* "ͅ*u"q"m*w"s"o2::*oë*}$*o͖ë::*më*{$*m͖}O*ʿ)һ# ¶"*)#": G:u >72 /2 2 =2    *$+|2( !)o>g^#V!.2N  2>?^el2222222: 2 : 2 ( *^#V#"( 2e G2m 2k ( 2g ( 2s !_^#V" 0( 2u <2 / : 2 : 2 ( 2w ( 2i ( 2y 1<2 /:: 2 : 2 ( 2} Q<2 /Z: 2 : 2 ( 2 ( 2 ( 2 ~<2 /Ç: 2 : 2 ( 2 ›2 çG>2 xҰ>2 Ҿ=2 >>2 /2 2 2 2 2 2 : 2 2 2 2 2 ɯ2n#:u 2Q$: 2u :s 2z$͡*o*m:s "!"%l5*:G*:Y*m*͸r*oMr*oM*͸r*m*m*y͸–*o*{͸–*"x2%*y*m2"}͏"*{*o2"͏"*͸|g}o>zW{_2"͖DM͝> x >`i:L&#>2G2+44>"m*K DM* "͏:ʀ]#>_+"o*$K *}K *"͏2*o x2*{ x2::*y*m͖"}*{*o͖":G2x*{*y$"y"{:G>>2x*o*m$( 2;$<*`"G$*b"K$o&))  "=$"q#`i"?$ "A$"s#`i"C$*`"I$*b"M$*C$*j#͸ژ*h#*?$͸ژ: i* "O$: 2 : 2 !: 2s =ʔ* ʑK*"k$*h#"W$*j#"U$*?$͸Ҵ"U$*W$*C$͸"W$*U$"S$͖#"E$:n#>2i$2a$:;$2g$*G$"`*K$"b "Y$`i"[$ "]$PY*S$"_$͖"m$2y$*S$*[$͖G:y$ʾ*[$*_$͖"w$|ʾ*Y$*]$͖GZK "o$*m$|kGK DM*o$*w$|ʅGK DM)}o|gNzW{_xʨK *]$*a$#"a$+)q# s#r:g$=2g$*]$"Y$*_$"[$:a$Xͫ:a$<2i$!q#^#V#N#F#`i͸M"y"m"o*h#͸*j#͸DM*h##1*j#͖"*}*| !xUgPY*BKͤ *x z>4uu2#*|?͏K ڷ :#ʷ*}|ʷ|*÷*{$͸PY*q|*> ͸*s *s*q*"x2$>2$|g}o *l#͖*$: .O: yGCHHw* *{$͸\"{$|g}o^#"$"$ *}$|ʕ|! #Û!"}$"$͸ҧ"$"o# y#"$`i"o#"$*$"$$*$K "$"$*$#"$*$"$>>A>*$"$> > >>K:$:$> >>2> > !!$6#zY2$*$*$DM:$~GÐ*$͝+|„ x*$p!ͷxG,%¢_~*$ º-`Disk Write Error, Temporary File : GSXTMP. $Disk Read Error, Temporary File : GSXTMP. $GSXTMP $$$GSXTMP $$$888>T8|8T|DDD|D((D                                      @@ B$$B  ""DDUUUUUUUU  HUUUUUUUUD! @D$"H  !D$AID$H! DDBI !$II$ I IBI$I"$DDB"I!"I!$$BI$I $II$A$H$"D$I$"I$BD$H B$I$BBI "D $" @ @!D" "$$II$ I$I$$HHIH$@HDH$@@H$H$H$ !$! DA $"H B@! BA"HI$I DH"I"I"I$A""$$HIH$!! I!HI D"@ $$ JI$ B$I I$HHHH"DDD "I$II$I $HHIHDI$$$$H$D$B$D$I A @$@I"DH$H"DHII$BH!""AHD"BI$I"$I"I$ $BA" $I"HI$ !$DI"HD$DH B @DB"!DA$D$"D!"$ D$AAB@@DHDDIID@$""I$@$$HB!$I!$H"@$BH DD$! G:l 2j *i:d G:j w#6#:l w#6# *i:j w*k6*$#"$> ͏ *c^#V!}քo|g` Q>2f ͏ !~ ^#V*gs#r *$#"$>͏ *c~ڢڤ>*gw#6=͏ ͪ2 >*$#"$>͏ *c~>*gw#6=2v ͏ *$#"$>͏ *e##F#~x` >`>2n 2h ͏ *i6#6#:n w#6*k6ͪ2 >ͪ2 >*$#"$>͏ *c~hj>*gw#6͏ *$#"$>͏ *c~ڏڑ>*gw#6͏ ͪ2 >*c~ڵ>*gw#62: <͏ :͏ *$#"$*$#"$> ͏ *c~>*gw#6=G >2 x͏ : *$#"$*a~͏ *a##~2͏ *e":ͩ*$"$ ͩ*$"$ =?: *$#"$*a~͏ *a##~͏ *e"ͩ:n o&͕ *$"$ͩ:n o&͕ *$"$=ˆ: *a~-2*$#"$*a~͏ :͏ !""*d "*j *&"*l :f NJ "*d J "*>Ðg"*d J "*>ÐJ J "*d "*>ÐJ "*d "*> ""2͏ *e"ͩ**$"$*$"$ ͩ*|!*$"$*$"$ **$"$*$"$)2Epson1.1LR7 01 Oct 83Serial No 5000-0884-003481!a ͯ *a~"k6#6"`!mo>g^#V` d49``2`@Nu```````*a ~=*g6#6#6#6*$#"$> ͏ *e##F#~x`>`>2l 2d ͏ :d**$"$*$"$*c":ͩ{͏ = : *$#"$!""!""*a~͏ *a##~2.͏ *e"23:.ͩ:3‚bk"/*$"$*"*ͽ" ͩ:3³<23bk"1*$"$*"*ͽ" =r*/ *1 * * * * *a ~=$: > ͏ >͏ >:: > ͏ >͏ >͏ >2!*$#"$*e"!"#>ͩ*$"$ ͩ*$"$ =R*\U!r#s! r#s! r#s! r#s*\U! r#s! r#s! r#s! r#s*\U! r#s! r#s! r#s*\U! r#s! r#s! r#s!"#*#~#"#͏ : 6 *:K ͷK **ͷh *F#!X ͷb *#"!"x"!ƒ H T 7 *w#"X ͷʢ !"' 7 :!(ͯ <2û z͏ & {͏ & ' W' _' G' O*"!X ͕L |< ! *#"! "*$#"b : 2 : 2 ' ' 2X :d 2G "l`i"n"` :X ڨ :X >“ >2:X >¢ >2 :X >´ >2:X > >2=F' eo&d "Z *j :X J "^ *l J #!=2!*#r#s#"#>2%!xGyO4|g}ozW{_:%=2%$33yUÍx/Gy/O>=fÌ)ڀ)q, z^33^)҇, ^$%J {ozgz{z?z?{zz{͜bk͜bk|!͜bk}o|g|DM!x y )   |J |J Q z+ ] x)yOxGyxC GyO#=/ ogeo+ + )f #^ OH  `iůJ !zW{_Ғ y O|g}o „ Ҡ #͎`i͎DM>))}o|g =µ )*$| ͺ ͕!"$"$"$ 7?` "^ *l +*n|!"zH*^ :X 7*l"l2Y *n"n>2Y *n"r*l"p*Z >F:G>xl:G:X ҄Ç=p=d:X Ҫ*n"ró*l"p=_=#Y*p:#+"p*r:#+"r*l|*b ͷ*nx2*zx2:7: 2 : 2 ' 2>2X :h 2G2n :v o&d "Z >22= "l`i"n*n +*l* ͷґ*n +*n"zHZJ:$G*$"#*$"#|!"#\E*#+|xŸ*#"$ß/_b ! <ͯ : ``0*" *" *" *" *cp ͯ !r 5!v 5>2d 2h 2b 2f 2 2 2 2 2 2 2 2 2 2 2 =2 2 2 2 2 2 2 2 >2l 2n ==2j !b  <ͯ 2 !"$"$!"$"*k66-#6*g! Zͯ *i!J ͯ ~# x¯ : » !"!ƒ !"!"!~   *$+|1' !(o>g^#V!-1M  1=>]dk1111111: 2 : 2 ' *^#V#"' 2d G2l 2j ' 2f ' 2r !_^#V" 0' 2t <2 / : 2 : 2 ' 2v ' 2h ' 2x 0<2 /9: 2 : 2 ' 2| P<2 /Y: 2 : 2 ' 2 ' 2~ ' 2 }<2 /Æ: 2 : 2 ' 2 š2 æG>2 xү>2 ҽ=2 >>2 /2 2 2 2 2 2 : 2 2 2 2 2 ɯ2#:t 2u$: 2t :r 2$͠*n*l:r !!"$k4*:G):X*l*ͷq*nLq*nL*ͷq*l*l*xͷ•*n*zͷ•)"x2$*x*l2"|͎"*z*n2"~͎"*ͷ|g}o>zW{_2"͕DM͜> x >`i:K%#>1G1+33>"l*~J DM* "͎:\#>^+"n*$J *|J *"͎2*nx2*zx2::*x*l͕"|*z*n͕"~:G2x*z*x#"x"z:G>>2x*n*l#"' 2_$<*"k$*"o$o&))  "a$"#`i"c$ "e$"#`i"g$*"m$*"q$*g$*#ͷڗ*#*c$ͷڗ: h* "s$: 2 : 2 !: 2r =ʓ*~ ʐ]*"$*#"{$*#"y$*c$ͷҳ"y$*{$*g$ͷ"{$*y$"w$͕#"i$:#>2$2$:_$2$*k$"*o$" "}$`i"$ "$PY*w$"$͕"$2$*w$*$͕G:$ʽ*$*$͕"$|ʽ*}$*$͕GYJ "$*$|jGJ DM*$*$|ʄGJ DM)}o|gMzW{_xʧJ *$*$#"$+)# s#r:$=2$*$"}$*$"$:$Wͪ:$<2$!#^#V#N#F#`iͷL"x"l"n*#ͷ*#ͷDM*##0*#͕"*|*~| !xTfPY*~BKͣ *w z>4tt2"*|?͎J ڶ :"ʶ*||ʶ|*~ö*$ͷPY*p|*b ͷ*r*r*p)"x2$>2$|g}o *#͕*$: -O: yFBGGw* *$ͷ["$|g}o]#"$"$ *$|ʔ|! #Ú!"$"$ͷҦ"$"# y#"$`i"#"$*$"$$*$J "$"$*$#"$*$"$>t"l"p}2$*w$"r"n"z"v}o&*$~2$:$O:$= 8go" "2:$=2$*w$#"w$:i$=2i$: 2 : 2 2r *k$"*o$":_$<*m$"*q$":u$2t :$2r *s$" =2$>2$!#"$*$^#V#~#foͷ*$s#r#s#r+*$##"$:$<2$G:$ҹ=2$®' =<2#:r 22r ͖:2r  "p"l`i"r"n=j "x"t`i"z"v* "̈́*t"p"l*v"r"n1:Œ:*nê*$*n͕ê::*lê*$*l͕}O*ʾ)Һ# µ"*)#": G:t >72 /2 2 =2 >A>*$"$>>K:$> >>2> > !!$6#zL2$*$DM*$:$oì*$"Z*Zxͽ"$:$Ϳ=ŒBK*Z"Z|ʬ|u:+|*$ DMd!xG,%_~*$ -`Disk Write Error, Temporary File : GSXTMP. $Disk Read Error, Temporary File : GSXTMP. $GSXTMP $$$GSXTMP $$$888>T8|8T|DDD|D((D                                      @@ B$$B  ""DDUUUUUUUU B@ $I D @@"B$H!    $H!B"@!$"!!@!B$H$$I$""@$$!$ID$H$DBDBI$"I$HI"!$!$IHI"DI$I$D$I$$H@"! II$D"@HDAA@B  DDHI$I$ I$I"I$H$ $H"H$I "H$BI BA @ I"D "@ B@"DHA$D$$!D"DI ""$DD"I"H$H$BB"B$""!@"D IH@UUUUUUPI"@H "$$H$$"D$A"DI$ $H@H!$$$$ $I$I$I"H I$HI$I A!I$$ D$$ HD$$$I$$B$$DD $ DI$DHD$I"@H"D@H$DIB"I$"$D"I$$$@ D"B$"$$I$I"DBDHH$"  $$HD$D H"HHBHBHD!I HI B$Aw#6=G >2 x͎ : *$#"$*`~͎ *`##~2͎ *d":ͨ*f$"f$ ͨ*h$"h$ =>: *$#"$*`~͎ *`##~͎ *d"ͨ:m o&͔ *f$"f$ͨ:m o&͔ *h$"h$=‡: *`~,2*$#"$*`~͎ :͎ !""*c "*i *&"*k :e M~I "*c I "*>Ïf"*c I "*>ÏI I "*c "*>ÏI "*c "*> ""2͎ *d"ͨ**f$"f$*j$"j$ ͨ*|!*h$"h$*l$"l$ **h$"h$*l$"l$*)1OKIDATA1.1 01 Oct 83Serial No 5000-0884-003481!` ͮ *`~"j6#6"_!lo>g^#V_ c38__1_?Mt_______*` ~=*f6#6#6#6*$#"$> ͎ *d##F#~x`>`>2k 2c ͎ :c *f$"f$*j$"j$*b":ͨ{͎ =: *$#"$!""!""*`~͎ *`##~2-͎ *d"22:-ͨ:2bk".*f$"f$*"*ͼ" ͨ:2²<22bk"0*h$"h$*"*ͼ" =q*. *0 * * * * *` ~=#: > ͎ >͎ >9: > ͎ >͎ >͎ >2*$#"$*d"!">ͨ*f$"f$ ͨ*h$"h$ =Q*\U!r#s! r#s! r#s! r#s*\U! r#s! r#s! r#s! r#s*\U! r#s! r#s! r#s*\U! r#s! r#s! r#s!"*~#"͎ :G:k 2i *h:c G:i w#6#:k w#6# *h:i w*j6*$#"$> ͎ *b^#V!}քo|g_ P>2e ͎ !} ^#V*fs#r *$#"$>͎ *b~ڡڣ>*fw#6=͎ ͩ2 >*$#"$>͎ *b~>*fw#6=2u ͎ *$#"$>͎ *d##F#~x`>`>2m 2g ͎ *h6#6#:m w#6*j6ͩ2 >ͩ2 >*$#"$>͎ *b~gi>*fw#6͎ *$#"$>͎ *b~ڎڐ>*fw#6͎ ͩ2 >*b~ڴ>*fw#62: <͎ :͎ *$#"$*$#"$> ͎ *b~>*f=2*r#s#">2!xGyO3|g}ozW{_:=2#33yTÌx/Gy/O>=eË))p, y]33])҆, ]$%I {ozgz{z?z?{zz{͛bk͛bk|!͛bk}o|g|DM!x y )   |I |I P z* \ x)yOxGyxB GyO#=. ogeo* * )e #] OG  `iůI !zW{_ґ y O|g}o ƒ ҟ #͍`i͍DM>))}o|g =´ *$| ͹ ͔!"$"f$"h$ 7?` "% *k +*m|!"yG*% : 6*k"k2 *m"m>2 *m"q*k"o*! >F:F>xk:F: ҃Æ=o=c: ҩ*m"qò*k"o=^=#X*o:#+"o*q:#+"q*k|*) Ͷ*mx2*yx2:7: 2 : 2 & 2>2 :g 2F2m :u o&+ "! >22= "k`i"m*m +*k* ͶҐ*m +*m"yGYI:x$G*h$"S#*{$"W#|!"U#S>*U#+|xž*Z#"v$Þ _a ! <ͮ : ``0*" *" *" *" *bo ͮ !q 5!u 5>2c 2g 2a 2e 2 2 2 2 2 2 2 2 2 2 2 =2 2 2 2 2 2 2 2 >2k 2m ==2i !a  <ͮ 2 !"f$"h$!"l$"*j66-#6*f! Zͮ *h!I ͮ ~# x® : wº !"w!‚ !"K!"M!~   *$+|0& !'o>g^#V!,0L 0<=\cj0000000: 2 : 2 & *^#V#"& 2c G2k 2i & 2e & 2q !_^#V" 0& 2s <2 / : 2 : 2 & 2u & 2g & 2w /<2 /8: 2 : 2 & 2{ O<2 /X: 2 : 2 & 2 & 2} & 2 |<2 /Å: 2 : 2 & 2 ™2 åG>2 xҮ>2 Ҽ=2 >>2 /2 2 2 2 2 2 : 2 2 2 2 2 ɯ2Y#:s 2<$: 2s :q 2e$& 6ww w*K:J ͶJ *M*Ͷg *KF#! Ͷa *M#"M!"Kx"w!‚ G  7 *Kw#"K Ͷʡ !"Kw 7 :w!O(ͮ ww<2ú z͎ % {͎ % & W& _& G& O*K"K! ͔K |; ! *M#"M! "K*f$#") : 2 : 2 & & 2 :c 2F "k`i"m"' : ڧ : >’ >2: >¡ >2 : >³ >2: > >2=E& eo&+ "! *i : I "% *k I # 2&$<*K"2$*M"6$o&)) "($"\#`i"*$ ",$"^#`i".$*K"4$*M"8$*.$*U#Ͷږ*S#**$Ͷږ: g* ":$: 2 : 2 !: 2q =ʒ*} ʏ^*"V$*S#"B$*U#"@$**$ͶҲ"@$*B$*.$Ͷ"B$*@$">$͔#"0$:Y#>2T$2L$:&$2R$*2$"K*6$"M "D$`i"F$ "H$PY*>$"J$͔"X$2d$*>$*F$͔G:d$ʼ*F$*J$͔"b$|ʼ*D$*H$͔GXI "Z$*X$|iGI DM*Z$*b$|ʃGI DM)}o|gLzW{_xʦI *H$*L$#"L$+)\# s#r:R$=2R$*H$"D$*J$"F$:L$Vͩ:L$<2T$!\#^#V#N#F#`iͶK"w"s"m*S#Ͷ*U#ͶDM*S##/*U#͔"*{*}| !xSePY*}BK͢ *v z>4ss2!*|?͍I ڵ :!ʵ*{|ʵ|*}õ*f$ͶPY*o|*) Ͷ*q*q*o("x2$>2$|g}o *W#͔*n$: ,O: yEAFFw* *f$ͶZ"f$|g}o\#"n$"t$ *h$|ʓ|! #Ù!"h$"r$Ͷҥ"v$"Z# y#"x$`i"Z#"x$*t$"$$"$*n$I "p$"}$*v$#"{$*p$"y$*"k"o}2^$*>$"q"m"y"u}o&*V$~2\$:^$O:\$< 7go" "2:T$=2T$*>$#">$:0$=20$: 2 : 2 2q *2$"K*6$"M:&$<*4$"K*8$"M:<$2s :e$2q *:$" =2N$>2P$!\#"`$*`$^#V#~#foͶ*`$s#r#s#r+*`$##"`$:P$<2P$G:N$Ҹ=2N$­& =<2Y#:q 22q ͕:2q "o"k`i"q"m=i "w"s`i"y"u* "̓*s"o"k*u"q"m0:‹:~*mé*h$*m͔é::*ké*f$*k͔}O*ʽ)ҹ# ´"*)#": G:s >72 /2 2 =2 $*n$"$> >>> 3>>>>>!!$6#zE2$*$*v$DM3:$v*n$̓+|j x*y$\!͠xG,%ˆ_~*n$ £-²7`Disk Write Error, Temporary File : GSXTMP. $Disk Read Error, Temporary File : GSXTMP. $GSXTMP $$$GSXTMP $$$͟*m*k:q !"#j3*:G(:W*k *Ͷp*mKp*mK*Ͷp*k *k*wͶ”*m*yͶ”("x2#*w*k2"{͍"*y*m2"}͍"*Ͷ|g}o>zW{_2"͔DM͛> x >`i:J$#>0G0+22>"k*}I DM* "͍:~[#>]+"m*n$I *{I *"͍2*mx2*yx2::*w*k͔"{*y*m͔"}:G2x*y*w""w"y:G>>2x*m*k""k                        888>T8|8T|DDD|D((D             I$H$A$I$DI!!$ IA" HD! "HA"D$H@ @@"! "$""$D"D @D!!$$ I"$HI$B$D$A"DDHDD"I$ HD$!$I"DDB $D$$*$ D$@$DI$H""I!""I"DI$D"$I$I$$!"BI$I"II$$ HHHD"$I H$ $! $B!$HI@$I H"$I"I$I$II HH$I! $I$$$HD D$H" $$$DHDI$"!DII"H $!ADH!DHH$!HD"$"$$!HD! !A$$$IHH$@ D! !$$ HB!ADA"D H @@ B$$B  """"""DDUUUU $ UUUUUUUUAI @"" D$HB"A$HB"! DBI $DBBB HI$I$HD"D$$ I$ IB$H $HI$$HDI $$$DBI$BI$""  DI$HI$I $H" DB$ $I  $$ D !@ $  $22 A:DDFXHR8 21 A:DDFXLR7 00 A:DDBBC0 01 A:DDBBC1 #"^sG!~Yڸpsq,mfudaÏډX~HXDDBBC0 PRLR234567DDBBC1 PRLT89:;<=PIP CM:>?@ASTAT CM*BCDASSIGN SYSGSX SYS FDDFXHR8 PRLvGHIJKLMNDDFXLR8 PRL`OPQRSTDDFXLR7 PRL`UVWXYZDDCITOLRPRL`[\]^_`GENGRAF COM aDDOKI84 PRL`bcdefg%!9"&1^#V# *&U$! "6#6! "6#6! "" !c! "6#6! "6-#6!"U%*U%-"hÉ*U%#"U%+N*U%)! "*U%)!$""]!"U%*U% "©*U%#"U%+Ï*U%)! "*U%)!8%""Þ! "##""$! ""}2Q%! ""}2T%! ""}2P%! " "}2R%! ""}2S%!"$!}2$!"$p ͐p !}2$ͤ!"$!"$*$Jp p ! " "ë! "6 #6! "##6P#6!! "6#6 !! "6#6! "6#6! " "͒ ! "6! "6#6! "6#6! "##6#6! "6#6! "6#6p ! "6#6! "6#6p p ! "! ""+͒##"$"*$Jp ! "6#6! "6#6! "##6#6p ! "! ""}2Q%"p ! ""}2T%" !}2T%! ":T%Ͷ""p ! "6#6! "##6#6! "6#6p ! "! ""}2P%"p ! "! """p ! "! ""}2R%"p ! "6#6p ! "6#6p ! "! ""}2S%"p ! "6#6! "##""$p#6e!! "6#66!! "6#6! ""! "##" ! "6#6:R%Ͷ"w! "! ""/ ! "͓!! "6#6$  O   p :Q%Ͷ"w! "##"! "r p :P%Ͷ"w!"U%! "##")*U%"y*U%#"U%+)! ""*U%#"U%+)! "":T%Ͷ"+ͭ"p :R%Ͷ"w! ""##! "##" ! "! "" p p !J! ""! "##"! "" $     n Q $ yv W  |  |spOI p ̀$! ""! "##"*%c# i`6#6! ")"" "#"+)! """#"+)! ""ͯä L! 6#6! *%"! *%"! """_%! "##""a%i`6#6! "+)""X L"##"5 ")! ""##)! """"ʋ !"c%Ñ !"c%"#)! ""###)! """" !"e% !"e%!d"##)! """###)! """)! ! "##"ͯ! ""! ""ͯ! ""! ""ͯ! ""! "##"ͯ*$Jp ! " ":S%Ͷ"w! "@ ! ""!"! "! """! "##"!"! "##! "##""! " "",:S%Ͷ"w7:Q%Ͷ"w! " ""! "6#6! "##6#6! " ! """! " ! """! "! """! "! "! " "++w  $"""#)! ""! 9")! """m%"#)! """o%!"q%! ")! "! *_%*a%"##)! """###)! ""! ")! "ͤ! 9"! "#c#ʐ *_%*a%! "Q! *%"! *%"! "#"+! ""# ! "++"! ")! "! *_%*a%"##)! """###)! ""! ")! "ͤ! 9"û "##)! """_%"###)! """a%"##)! """###)! ""! "Q! """! !# " "!͈"! !# " "!U͈"! ! ""!# "##!# "##"!x͈"!# "!# ""!x͈"!# " !# " "!x͈"! 6! ͵"! ""X! ͵"#}+! "É! "! ""L! !# "!# "##""P#]"U! 6#6! """ʗ! !# " !# "##""P#]"ç! ! ""ð! """! !# "!# """P#]"! 6#6! "! ! ")! ! ""I! "#"+! ""I! "++"K $U$! ""g%! ""i%! "c#ʍ! "! "ͯâ! "! "̀$! "! ""! "! ""!Ä! "*c%n#! "*c%n#"! "*e%n#! "*e%n#"ʁ*g%! "P#*g%! "P#n#*i%! "P#*i%! "P#n#͋"! ""P#Ä!|$̀$! ! !""! " "! ! "! "͒#! "͒#"! "#"+å! "|$""7! !# "!# """P#]"G! ! ""ð! "! ""ʎ! !# "!# """P#]"×! 6#6! """! !# "!# """P#"! ! ""ð! """'! !# " !# "##""P#]"0! 6#6! "! ""v! !# "!# "##""P#]"Æ! ! ""ð$JJ! !# " ! "!s%͵"]"n#"! !# " ! "!{%͵$!"]%"[%! ! "! "P#*e%n#"! ! "! "P#*c%n#"! "c#r! "*e%n#"]%i`6#6"! ""*[%"[%! "! 1! ! "i"]%*[%*[%n#*]%*]%n#͋"y*[%*c%n#"[%*]%*e%n#"]%$ ̀$*q%! ""q%*[%*c%n#*q%1!di*c%n#*m%"_%*]%*e%n#*q%1!di*e%n#*o%"a%$̀$!% "##"+͒#"! !% ""!͒#"! ! ""! 6#6! """! "#"+! ! "#͒#"]"n#"! !# "!# " ! "!s%ͻ""n#""! ! "!%͵"}! ! "!%͵"}! ! "! "P##"! ""<! "! !# "##! "!{%!# " "!x͈͵"n#""! "! "! ͵"! ͵"! "! "! "! "!# ""!# "##"!! "!9<! !# "##! "!{%!x!# " "͈͵"n#""! "! "! ͵"! ͵"! "! "! "! "!# ""!# "##" ")! "#"! "! ""ž$!9N#F#^#V>͙SPT]=C!9~#fos#r#q#p!9N#F#^#Vͧ^#V#N#F>͚ ґDM=…ɷ{_zWyOxGy/ox/g#U$!!!!! "! "U$!!!!! "! "U$!}2%! "! "! "! "ͯ!}2%U$!!!!! ""! "##"! ""! ""! ""! "##"!! 9!!!U!! ""! ""U$! ͵"}2%!!!!! "̓!9<$bbbb<! ! "#͒#"$U$! ""}! "W#Ä! "|̀$! "! "1! !i"! "|$̀$! 6i`6#6! 6#6! 6! "c#k! "+"#! ͵"+c#! ͵"c#M! "! "! "! "!! 9b! "! "! 6y! "+"#! ͵"c#e! "! ""! ! "! ͵""! "+"#! ! ")! "P##"! """x͒#"!! "! "!!!U!! "! "!}2%U$! "+)!%""%! "+)!%""%U$! 6#6! ""$!!*$"ʭ*$+!õ*$!! "!U$! ""! 6#6! ""! 6#6! ""$! ""$:%Ͷ"+c#3! ! "!x͈"! ")!!! "))!!*$c#]*$c#}2$̀$!}2%!!! "!!!$!!!!!!!U$! "))!%"*$P#! "))!%##"*$!!! ")!%"! """3! ! "! ͵""! 69! 6! "#"+! ! ")! "#"y! "! ""$̀$! 6i`6#6! 6#6! 6! "c#)! "+"#! ͵"+c#! ͵"c# ! "! "! "! "!! 9 ! "! "! 67! "+"#! "! ""! """x͒#"! """ʟ! 6! ! "! ͵""å! 6! "+"#! ! ")! "P##"! ! "! ͵""! "#"+! !!!!U$!!! "! "Q U$!!! "! "Q U$!"%*%! ""ʈ *%#"%+)! ""!Z !!U$! ""ʰ !! ! "P#!̀$! "+"! ! "+"!!"!! "!$!!!9!~1!!9!#!O>.&"!!(G>!!!|!>!Ͷ!6!>!>!>!!!>!> !>!Ͷ!>.&"!!9~#fop4#w#q4#w*!>!}!|!&o!>O!%!7$! ""&6Q! *&&$I @@II DA$B"@ @"   @  @" @BH$ ! @$DD D! $" @$" I""@!B$D$ D @A@  !"@ $D" H "$  @@$DDDDDDDDDDDDEBH!$BBD@$$!! $$*&##"&*&#͵""&*&+"&#|J"*&#"&+*&#"&+͵"}#"*&6! "͵""h"!o"! "|͍$U$! " "ʏ"! t"!! "$$U$! "t"i`~og~_Wi`~#fo^#V}|}o|g}o|g}o|g#####-##########-zW|gz*#{!||g}o/#)=#|g}oD#{ozg\##|/g}/o|l#go,DM!yz#xGyOʐ#{_zWt#|š#]T||#W#z#W###W#W#|#]TDM>){_zW#z##{#}o{_zW=$$I" A  "H$ DD@" @ D"D@@@ D "H @@ I$ H@A $ H$ $H "D "D!$H@H" $H$@H $$!$BA"$HDH@DDI !  @@! $$ !$@"""@ $DB@@I"""@ DD$I""@H$@""HDD$DDDDEH$@DD "D H @!@$!@B DDDP ! H ! !  !$ !!$@ H$$H@ @D#N# $#~#$~$##$#~#fo!9^#V#No`!9DM*&*&*&*&*&!9DM^#V#9DM*&*&*&*&*&^#V#9DM"&"&"&"&"&"&"&"&"&"& o g9~#fo9 55 .+*oX "H@@B @@B@ " @@@@ @@@@"@ "DH@H$@D BH@D @@!D@A @H $@HBDDAB$H !$B"D H@$A"HADH@H$ @$ !DD@"" @$!@B DDDP ! H ! !  !$ !!$@ H$$H@ @D}&!9"&1^#V# *&%! ͅ#6""DD@ @D $@BD !A @@ I@D@@ H!B !@ H  @ @D @B  @ A! $I@$H A $@A"I"! "@$@A@ "ID@@ !@@@@ !!I! @$IHD @@$ @@@ @ DD !! B#6! ͅ#6#6! ͅ#ͅ# !͙! ͅ#6#6! ͅ#6-#6!"&*&-ͷ#hÉ*&#"&+N*&)! ͅ#*&)!%ͅ#͎#]!"&*& ͷ#©*&#"&+Ï*&)! ͅ#*&)!%ͅ#͎#Þ! ͅ###ͅ#"%! ͅ#ͅ#}2&! ͅ#ͅ#}2&! ͅ#ͅ#}2&! ͅ# ͅ#}2&! ͅ#ͅ#}2&!"%!}2%!"%n * n !}2%N !"%!"%*%Hn n ! ͅ# ͅ#ë! ͅ#6 #6! ͅ###6(#6Ͳ!! ͅ#6#6ͻ!! ͅ#6#6! ͅ#6#6! ͅ# ͅ#! ͅ#͊#!͸#! ͅ#! ͅ#ͅ#͎#! ͅ###͊#!͸#! ͅ###! ͅ###ͅ#͎#! ͅ# ͅ#ͩ#*:&x#u5:&x#u! ͅ# ͅ#ͩ#! ͅ#6#6! ͅ###6#6! ͅ# ! ͅ#ͅ#͎#! ͅ# ! ͅ#ͅ#͎#! ͅ#! ͅ#ͅ#͎#! ͅ#! ͅ#! ͅ# ͅ#++u$#ͅ#̓##)! ͅ#ͅ#! 9̓#)! ͅ#ͅ#"/&̓##)! ͅ#ͅ#"1&!"3&! ͅ#)! ͅ#! *!&*#&̓###)! ͅ#ͅ#̓####)! ͅ#ͅ#! ͅ#)! ͅ#͢! 9͎#! ͅ##%$ʎ *!&*#&! ͅ#O! *y&͎#! *{&͎#! ͅ##͎#+! ͅ#͸#! ! ͅ#++͎#! ͅ#)! ͅ#! *!&*#&̓###)! ͅ#ͅ#̓####)! ͅ#ͅ#! ͅ#)! ͅ#͢! 9͎#ù ̓###)! ͅ#ͅ#"!&̓####)! ͅ#ͅ#"#&̓###)! ͅ#ͅ#̓####)! ͅ#ͅ#! ͅ#O! ͅ#ͱ#!! ͅ#6#6! ͅ#6#6! ͅ###6#6! ͅ#6#6! ͅ#6#6n ! ͅ#6#6! ͅ#6#6n n ! ͅ#! ͅ#ͅ#+T$#"%͎#*%Hn ! ͅ#6#6! ͅ#6#6! ͅ###6#6n ! ͅ#! ͅ#ͅ#}2&͎#n ! ͅ#ͅ#}2&͸# !}2&! ͅ#:&x#͎#n ! ͅ#6#6! ͅ###6#6! ͅ#6#6n ! ͅ#! ͅ#ͅ#}2&͎#n ! ͅ#! ͅ#ͅ#͎#n ! ͅ#! ͅ#ͅ#}2&͎#n ! ͅ#6#6n ! ͅ#6#6n ! ͅ#! ͅ#ͅ#}2&͎#n ! ͅ#6#6! ͅ###ͅ#"%n ͅ#)! ! ͅ#͎#G! ͅ##͎#+! ͅ#͸#G! ͅ#++͎#I ͈%%! ͅ#")&! ͅ#"+&! ͅ#%$ʋ! ͅ#! ͅ#ͭà! ͅ#! ͅ#B%! ͅ#! ͅ#ͩ#! ͅ#! ͅ#ͩ#!Â! ͅ#*%&0$! ͅ#*%&0$ͷ#! ͅ#*'&0$! ͅ#*'&0$ͷ#*)&! ͅ#$*)&! ͅ#$0$*+&! ͅ#$*+&! ͅ#$0$͉͎#! ͅ#̓#$Â!|͈%B%! ! !͎#͎#! ͅ# ͷ#! ! ͅ#! ͅ#T$! ͅ#T$͎#! ͅ##͎#+ã! ͅ#|͈%B%ͩ#5! !# ͅ#!# ͅ#͊#ͅ#$[͎#E! ! ͅ#͎#î! ͅ#! ͅ#ͩ#ʌ! !# ͅ#!# ͅ#͊#ͅ#$[͎#Õ! 6#6! ͅ#̓#ͩ#! !# ͅ#!# ͅ#͊#ͅ#$͎#! ! ͅ#͎#î! ͅ#̓#ͩ#%! !# ͅ# !# ͅ###͊#ͅ#$[͎#.! 6#6! ͅ#! ͅ#ͩ#t! !# ͅ#!# ͅ###͊#ͅ#$[͎#Ä! ! ͅ#͎#î$HH! !# ͅ# ! ͅ#!5&w#[ͅ#0$͎#! !# ͅ# ! ͅ#!=&w#!"&"&! ! ͅ#! ͅ#$*'&0$͎#! ! ͅ#! ͅ#$*%&0$͎#! ͅ#%$p! ͅ#*'&0$"&i`6#6̓#! ͅ#͸#*&"&! ͅ#! /! ! ͅ#g"&*&*&0$*&*&0$͉͎#w*&*%&0$"&*&*'&0$"&͈% B%*3&! ͅ#"3&*&*%&0$*3&/!dg*%&0$*/&"!&*&*'&0$*3&/!dg*'&0$*1&"#&͈%B%!% ͅ###ͅ#+T$͎#! !% ͅ#͊#!T$͎#! ! ͅ#͎#! 6#6! ͅ#̓#ͱ#! ͅ##͎#+! ! ͅ##T$[ͅ#0$͎#! !# ͅ#!# ͅ# ! ͅ#!5&}#ͅ#0$ͅ#͎#! ! ͅ#!E&w#}! ! ͅ#!M&w#}! ! ͅ#! ͅ#$#͎#! ͅ#ͱ#:! ͅ#! !# ͅ###! ͅ#!=&!# ͅ# ͅ#!͆w#0$ͅ#͎#! ͅ#! ͅ#! w#! w#! ͅ#! ͅ#! ͅ#! ͅ#!# ͅ#ͅ#!# ͅ###ͅ#!! ͅ#!9:! !# ͅ###! ͅ#!=&!!# ͅ# ͅ#͆w#0$ͅ#͎#! ͅ#! ͅ#! w#! w#! ͅ#! ͅ#! ͅ#! ͅ#!# ͅ#ͅ#!# ͅ###ͅ#!!͎#! !# ͅ# ͅ#!͎͆#! !# ͅ# ͅ#!͎͆#! ! ͅ#͎#!# ͅ###!# ͅ###ͅ#!͎͆#!# ͅ#!# ͅ#ͅ#!͎͆#!# ͅ# !# ͅ# ͅ#!͎͆#! 6! w#! ͅ#͸#V! w##}+! ͅ#Ç! ͅ#! ͅ#ͩ#J! !# ͅ#!# ͅ###͊#ͅ#$[͎#S! 6#6! ͅ#̓#ͩ#ʕ! !# ͅ# !# ͅ###͊#ͅ#$[͎#å! ! ͅ#͎#î! ͅ#̓#ͩ#! !# ͅ#!# ͅ#͊#ͅ#$[͎#! 6#6! ͅ#! ͅ# ͅ#́!9:$````:! ! ͅ##T$͎#͈%%! ͅ#ͷ#{! ͅ#$Â! ͅ#|B%! ͅ#! ͅ#/! !g͎#! ͅ#|͈%B%! 6i`6#6! 6#6! 6! ͅ#%$i! ͅ#+͎##! w#+%$! w#%$K! ͅ#! ͅ#! ͅ#! ͅ#!! 9`! ͅ#! ͅ#! 6w! ͅ#+͎##! w#%$c! ͅ#! ͅ#ͷ#! ! ͅ#! w#͎#! ͅ#+͎##! ! ͅ#)! ͅ#$#͎#! ̓#͎#̓#T$͎#!!! ͅ#! ͅ#!!!U!! ͅ#! ͅ#!}2&%! ͅ#+)!e&ͅ#"y&! ͅ#+)!o&ͅ#"{&%! ͅ##ʑ! 6#6! ͅ#%$ʧ! 6#6! ͅ#*%ͩ#! ͅ#"%!!*%ͷ#*%+!*%!! ͅ#!%! ͅ#ͷ#! 6#6! ͅ#ͷ#-! 6#6! ͅ#"%! ͅ#"%:&x#+%$h! ! ͅ#!͎͆#! ͅ#))!! ͅ#))!*%%$ʓ*%%$}2%B%!}2&!!! ͅ#!!!!!!!!!͈%%!!! ͅ# ͅ#̓#ͷ#1! ! ͅ#! w#͎#! 67! 6! ͅ##͎#+! ! ͅ#)! ͅ##͎#w! ͅ#! ͅ#ͱ#͈%B%! 6i`6#6! 6#6! 6! ͅ#%$'! ͅ#+͎##! w#+%$! w#%$ ! ͅ#! ͅ#! ͅ#! ͅ#!! 9! ͅ#! ͅ#! 65! ͅ#+͎##! ͅ#! ͅ#ͷ#! ̓#͎#̓#T$͎#! ͅ#̓#ͷ#ʝ! 6! ! ͅ#! w#͎#ã! 6! ͅ#+͎##! ! ͅ#)! ͅ#$#͎#! ! ͅ#! w#͎#! ͅ##͎#+! ! !! ͅ#!!!!!!!͡"!!!!!!!!!!%! ͅ#))!&͊#*%$! ͅ#))!&##͊#*%!!! ͅ#)!}&ͅ#!!!%!!! ͅ#! ͅ# %!!! ͅ#! ͅ# %!"&*&! ͅ#͸#2!*&#"&+)! ͅ#ͅ#!!!!%! ͅ#ͩ#Z!!!l!! ͅ#$!B%! ͅ#+͎#! ! ͅ#+͎#!!̓#!! ͅ#!͈%!͙!͙!!!!!9!~!!9!#!O>.&ͅ#)! ͅ##͎#! ͅ#! ͅ#ͱ#œ͈%!9N#F#^#V>͗QNT]=A!9~#fos#r#q#p!9N#F#^#Vͥ^#V#N#F>͘ ҏDM=ƒɷ{_zWyOxGy/ox/g#%!!!!! ͅ#! ͅ#%!!!!! ͅ#! ͅ#%!}2&! ͅ#! ͅ#! ͅ#! ͅ#ͭ!}2&%!!!!! ͅ#ͅ#! ͅ###ͅ#! ͅ#ͅ#! ͅ#ͅ#! ͅ#ͅ#! ͅ###ͅ#!! 9!!!U!! ͅ#ͅ#! ͅ#ͅ#%! w#}2&!!!""͜"(G>͋"͜"͋"|͋">͋"x"!>͋">͋">͋"͜"͋">͋"> ͋">͋"x">.&""!9~#fop4#w#q4#w*">͋"}͋"|͋"&o!>O!&ͪ"$! ͅ#"s'6Q! *s'$!! $*s'##"u'*s'#w#"q'*q'+"q'#| #*s'#"s'+*u'#"u'+w#}"*s'6! ͅ#w#ͩ#*#!1#! ͅ#|O%%! ͅ# ͩ#Q#! 6#!! ͅ#$%! ͅ#6#i`~og~_Wi`~#fo^#V}|}o|g}o|g}o|g###-########-zW|gz#{!||g}o# @$DD DB@DHD@$ @@ DI  @IDE H@$"@  $H"@DHA  !"HA$$BDI@ @" IDDD@@A D"D@@@$$D"" $ !H@$ @D @D $H D $@H   A @@D"! D""I@I @@ D"$DD$H" !B A$@$@ @A  @@@ $DB@DH$ $@HH$@@ D)#|g}o${ozg$#|/g}/o|.$go,DM!y<$xGyOR${_zW6$|\$]T||h$$zs$$͎$$$$|Ž$]TDM>){_zWʺ$zں$°${ں$}o{_zW=$Ø$N# $#~#$~$##$#~#fo!9^#V#No`!9DM*q'*s'*u'*w'*y'!9DM^#V#9DM*q'*s'*u'*w'*y'^#V#9DM"y'"w'"u'"s'"q'"y'"w'"u'"s'"q' o g9~#fo9?jjH !A@DA" "  $ A H" @@@@@@@@H@D@@ $@$$ @@B$H@ @D $@BD !A @@ I@D@@ H!B !@ H  @ @D @B  @ A! $I@$H A $@A"I"! "@$@A@ "ID@@ !@@@@ !!I! @$IHD @@$ @@@ @ DD !! B .+*oX}'$I @@II DA$B"@ @"   @  @" @BH$ !""DD@ @D $@BD !A @@ I@D@@ H!B !@ H  @ @D @B  @ A! $I@$H A $@A"I"! "@$@A@ "ID@@ !@@@@ !!I! @$IHD @@$ @@@ @ DD !! B!f!fFwx:f:f:f=ʮ>0:f=ʮ:f7 ͘0:f7 ͘Y72f7͏7~#z > z̀ :f=*=yDO͛:f=7 Gy( ( (. 830)< %r G > ͒ G= x(:fʇf:f=( =:f:f>:f==:f:f#g?o =7Ȅ?="f>2f:f=:fO<( :f=( 0 f f>2fx2fÇ!"f:f= ͇ ͇x2f:f,d:f,d > 2f 0>0 2f2f4"fZ,>ԫ4DMz!ež>;>( (  xZ*k-es#r#>jyc!fͲd>jycͲd!/d~ >jycͲd͎bw#%>Ys#r#>s#r#Ys#r#*fYs#r#p!fͶd2f;>*f  >2f Z(#^#V#~#foͷ>*k ^#VZ*k0>8Y*k+F#}ogx(( ++~+ng!e x^#V#*k((:f( )0/  ^#V:f(! ~#fo<0r+s`i~#foͻ=! j,>(>͎bI,>(~>͘H͘HY>Zs#r#>s#r#6Z^#V#~#foͷ>*kbI*k+~}og#ȷ  &"frZc/dSerial number & customer J Mallard-80 BASIC with Jetsam Run-only Version 1.11 (c) Copyright 1984 Locomotive Software Ltd All rights reserved 1f?!e Direct Mode Ͳ>!fJ0r͋?+L>rT!͒G{3Z7 À<͐WkŚ`39[x3;3I1fR"kZ* Ͳ>͘ !&en*kX͒G|[P!`e*fe|}J͟ ß free bytes >2he!"fel<>/(+6""fe#~/ 6#<>d!d#<>: 9#͛O03ae<>/(׷#SMF"g"kz {2he 6mR>>t>Z>s#r#Ys#r#Ys#r#6*r Z>"f^#V#ͷ>^#V#~#fo*kj͎b*f;>>Z*kY*k+}og#~(( +++~+ng!e $ O~(>+> ( I0>8͘HbI¤>+͖I>( >;>(%>(ͫ40>0 +x( >;>>+>͖I>(  >>*( (4 0"(,(=(B(I( ( ((Ew#6M+6>> >>^>U>#M( eS>  yQ67(zorFile already existsDisc fullEOF metRecord number errorFile name invalidDirect command foundDirectory fullNot a keyed fileCannot lock fileInconsistent filesB-tree fullKey failure z @{ z 5(2{ z8'j͗cjcjè`jÌd "g,>,( ;BK~,>,~. >*g~#^#V((+++ ###^#V>+v+>F~8B̕d *lF͌dͲ\~_WxͣdGv#yZdex~G͕d! *lv\*æaúaarPP2g>"gp  _{ *dkY"g1f*bkŹ`39p *g!g0z( 5 *kn>6:gͯ *gͷ> ß*g*k>!!  !; *g| >er?! Undefined line  ?eͤ >! ePBreak in ß ß>0 :g ß2g!"g>>Iz( HY"g :g) y L>~(Iz(~͘Hy #n>>y #bI:g 2g2g*gͷ>*g*k >2g:gri 8wq8v q D2 G  (Unknown errorUnexpected NEXTSyntaaÑ0b 2b]bKb$b=bOb%a'd+vtb+ vab>(8F 8a"\!ld>& (I4=-6<^SނW ͵40 (͛dd"l 8#(88>(͛d+$^#V~_/d^#V ##^#Vqc>j>)#N>y6O058 >( ! ~#fo:g,dp >(K>)#͵4 *kqczS>>  4Ys#rbI4^#V*kz =9~( ,>>(́9jx]40>0>,>)>)]9>jf9͕d`c =&&&$kx errorUnexpected RETURNDATA exhaustedImproper argumentOverflowMemory fullLine does not existSubscript out of rangeArray already dimensionedDivision by zeroInvalid direct commandType mismatchString space fullString too longString expression too complexCannot CONTinueUnknown user functionRESUME missingUnexpected RESUMEOperand missingLine too longNEXT missingWEND missingUnexpected WENDRecord overflowFile number errorFile not foundFile type errorFile already openDisc I/O err]A]^=(j0>0ͣdjyZa(Ğd>)>(jͣd0> >)!'O!e yZC͝b!"g2g2g!e0!<=(0y2g"g!e0"hH :g̈́*h=!g"h!g"h͸>,z>, A nxE#(( >->#0> *g!e8:BK!$q#p>x(dOIRK6 @7 ( ~#> O( ̈́1$ 2w# :X0 ?   y BAS@ y<>T]~ <>,=#O: yQ@?8  7=y.͓.0 !e8 *̹ > ͻ?>? (x~#d 7.[]<>/\,;:=|>:5 >#C (!>:>#7>C>>O<>"͌>"PC(9(=x>!!!q#p#6>##=7ȷ>!͌( (9 >6#= \!!4 #4 #4!~~Ͷ0>8 !-% *.*~ (>.z> r> z)0>8ɯO :g8̈́)g);$ "h7!-~ȯ!̀"h ̀"hz(5~#> O:g8y*k$͗c| (M̈́4 7*h-6#6ѷ*h(!.~ +~>w 5>_P~7!+4# 4!m!.w+w*h.4 7 7?*h(!-~4^#Pqwq!.4y 5 6!)N#F!%~#fo'ecq#p!~ *h "!)N#F!%~_#~W!0  7+| *h.~= >khu>#GO H!h~ x u: h!h[eh5>#>#͐0>8 5>#5>$#!m0~#(͒ !>(0>> G>)(( % ` `-[e>.[e>#>>h#o&#  _  ͦ*+ O![e;ͻ͸7 ͵ď*[e;>8>g(>i*j!j{b*i*j' z(s#rh^=M *$!_ o!DM!%^#V "h>, _>ͫ4͌d *h!e8q#s#r0>82 $ym*h*h[e"hW48m*h*h[e"h48o!'0>0 BK N#F+(x( (q#p %>? !)6#6!"h!%~#foPY="h!"h>OB'eDM}o|g*h#"h!"h'e0DM7͂/!-6͂m!-w*hDM!"q#p#6!͗!-~(("h'd͗!, !( ~+n.d͗͡,dz!h>!͂! x/7 t%$& ͍%$'<WBj!j *j+͍%>i$';͇Z!i:j !iFxZL"Hx͊G͟8= y j yZ"jxus#rq"{Wa%&8 >g(͹ >f t%&͍%͍%Y ͍%ͬ>g0͹ >f ́ >e ͍%Y8>g(͹ >f ́ >e(7͚́ 7?7&*i*j!e7Ý ({:iG͟8͇2i!ipZ"i!j:i(ͩ*í>2iZ"i2i͜:i{{!j:i(W"iͩ*í2i:i :iO{>G͊8x2i:j!iGW 6#6###s#r#{ƀ_0 *k:kG! M!6>####~#foM!6>#~w:jO(!#~ #~ #~7(  (!N~0~O(5 #~+!6@#:jw#s#r#~#fo!#y+! !#~+ 6#6+ !#~+! #~O#^#V(!{_#~ #~ #~ +{8^ #~+,"(#~O#^#V#~#fo%#~w+1!8w! %1!w![e@!z*#<#͎&.#͎&4#.#R&0>0'>, *g!e8j{=(e0>0 xA8>@կ0M4#0.{$&%R$L"Z "i7*j"i2i:jͩ*í!"i͜0́ be8:i2i͊2iW"i= :iu~#fo:iu##~ ~bojg*j "jDM{!"i"jbk#:i=!Bj~<*jq#p#"j͇Gu r:iG##*jߖ "@j}0A06(:i(,:i:@j0#!j~( 5*"i"j*ip *j/*i*!j4Q *j ""i$i s#r"@jQ "j:@j!i\"*i"j88|8/͛84Q *j +#QͶ*jL"p #0%<#>23%>! >>7>@_ !/6# x ͎&4#.#R&#(?%͒$I%͜$!e>s [#*DM*g'e>28G>0>>,(ͫ4/dx]40>ͫ4I%:G`!Hy[e]4B$!>5_ *DM!%q#p!T! [eͩ!$I%!T [e0%ͺ! $$ $!4#!ѯ$́$"!^="O[e$!>6#= [e!$ͮ$ !$ͮ$8^#V # q MIOPENJetsam0!S~$6I%*#"0%?%*#"&%Ox2i#*jQ*j 2i i *@j ^eL"N #"i[e{xe *@j!i{xe[eL"N #[e"@j:@jG>!iO͊8y<:@j>!i͊8G:@jGL"!!e?:i{:iG{͜:iG͊ZxeL"*@j O +G7*@j|}O>!iG͊8Ox\"x :@jv6f%;O&͎&_&&y%(O&͎&_&͎&j&eͧ%*j#| >s9&9&O&0>8!!'~#fo+"j!_j~),d*jT!j [ey&͎&  0*l &#>(z(64 >,(&!_~,d(&!'~#fo/d(&!_~#G`xH[e*j|( D'"j*j#"j*j!6#6"jDMuwG~#ʏ+8s_+xFw+yNw+zVwʏ+80\ZQH0(  +~#W~#O~7G{0 #4(%+0‚+x #4(+~w+q+r7x0_~#W~#O~7G0~/w_>W>O>G{o+#~ _y({0ALe.(+=()+w+{o+o͕)A0͊.(0=͕.0&($8,*j+~#85(*jYzW#$,~L0e0w7y,*jA#("j"jx2jAͮ,(p,~#_,(-W0*j*j:jG#„,*jA+’,u,*jA+Vwz¥, ~#( (00~2-#~2-!M,,,*js#r#qP laOG:j_y0 A'+| *j'*j"jA'#{( !s#r|2:' q'{2*j)%*j*j% ~#fo=DM{( q'~#foq'~q'fo*jB%x8:((x=_WGͩ'x475A030GP0e0+~7x G_W+w'y+6='7G  | Oeo( () '|s#w#qA0G!0ẅ́*e0  >8+G/z0#|( ?zc/zy4 #= 4 7c/0z7`(x>/GT/!j6#ͩ' +(Tր_Wkb))))))y(|)y(()/("0+=y(( )/8-<_H(yOjW w# +#tO>o>gy,O͕)A0͊.(/<͕.0(+~GK-P0e0x0y.# ("j"jy2jP-*j0 5-~!j͖-+q ?-?78~-8:j(G*j*j#¯-~w?*j:jG~w-0( *j~ #"jx2j#"j7#~w-–-!j~:jG*jog+  "j~2a.#~2e.^#V#N*jz.0=)yOS.S.S.?z.?78y}.8 }o|gyO?)V.zy*j{#z +G#G~($Gx.wj>+w ¬.<7ɷ.wA0~ր7A0ƀwA0.ɷ.w?x0w67A0x1_c/<7+)0&)> '8&)>&jA)/<^)(j^)+ -+ 0!)0 o>g!)8 !)0!){'>_)W Hz@PC$t >hbx-yx*A0G30(0G!j(07(!G*j8 Đ/͐/Z/*L0e0*j(0G7*jx\*zGjw# ?*P?_0Y+Q*7zGj# c*P0x/G*jYW>w#{*^+~F*jz# (P(x ~6# QG~p#¦*{_00x(* ((#AzW#***js7(*wS##~#N#F#ng( >+0 8& (+./A"/ + <+~?"j "jz*jy74#= +6#475?*j+0 xw7 *jp#6+~wy=+6= cf1W3y͛dc>/s3>/(GT/ 18ͱ1+51T/. 0GZ3x(h300j+0T/C3 I*[k|(##-58-58Ò57~#fo ##*Vk #0:l= 7T]##~#0>n5@͜5*kL[Yͯ5+6= 5#{w#zw7O*Vk ~#0xbk O*Vk[e:l=BK~{w#~zw?7~(([>46:lͭ3-5F4>ͻ6~(([( *k+760*k+:lͭ3-50͒5xB4 ͻ6͒5F#^#V>Z~#fo!eB4"=## *l&"=7>:l :1k(zB4>Zs#r0>8~)(]>4>2l2Ukx͜5*kL[ͯ5`i##:l_p#:Uk :1k _ >Z^#Vs#T/dË b3`(y0(x>3~G0~'cO3s31/d1/d13{h3Z326D{25wr1~+)-f1)>../<.);840rc2c2>/=>3..2/0>.=a32)2)-2KW^8v;8+fc)+5r1 cM3s3>/T/cM3Яp23{T/O3>fc<.2-n(thy5#}]I+n"W3 232-Ë c>/T/M30;=C32 !w/zY{k|B}`} ~AL~+i2)T/h3a3Gͩ'jj+)r#"=B4 BKT]O["k+6 x ^)# ++s#r#:lͭ35ʹ7#^#Vz( #~0>7++*Vk!d7*VkZ"Vk~###N8y_jW2l6( w>(Z"Vk)>4w#0Z+>~0 80~88>02l>4͜3~#>2Xk8rI*kDM*kT]'e(͊8[e s#r"k*kDM'e(͊88 N#F#  [eN#F+[e"k͈3*k*k!e(^#V+##~͞35͐3*k*k!eV5~#<ͭ35^#V#V5Fx@> x(>80>8?7~( >>):lͭ3*Vk~͞3-50I90>8!jA {'+93)(0 j'!j)A {' a3s3-.?c!jé'!jé'!jͩ'+>fc͈3*k"k"k"k!j>6͕3!'k> 6#= >[*k+DMoojg*k+DM'okg14 21k22kZAy8k- >d07O>30>8>:2k14 % 021k>22k*k*k!e   ͫ4>jx]4Gedxc͕d²d/`ödͫ4>,ͫ4x MkͶdͶd!MkͶd  50>8?768B(?7688y͞35-?78!͜35b5?78y͞35:ln5*k+:lGO?74?7:lͭ3-5 ^#V#*k8ex[e"kc8!"[k"Yk*[k*Yk>Z"Yks#r#w#w#s#r*Yk"[k*YkZ^#V#"Yk##^#V"[k>Zʹ7r7*Yk##5:lGͭ3N#Fx*k+ V5#N#F# N# 'e(:###~#fo V5~#:~#N#Fae(>:ͫ4͌d;>;ͫ4͌d!f͐;-\f4>:8 >?z> z;5;8 !:eͫ4>;0>8?Redo from start ;ͫ4͕d!f ;-\ ͪ;N0;]40>8>~;2]k>"\p\0>>>fI 8 vi::K4.:>>jJMT]>Z^>> H4CS$SWTTThfI7W9t>IS(_T\T[w">>vT[*kկ2hk,ͱ?~ >-O>G~d8d@&FAd(#lA: ~#(#(@!@eA! @e8 >? y ?~:( #" ͫA2hk~#d́CC0/yd0( ( ~@d8@>??=+#~d8@8># >???~d0?#>2hk7O!@e2hkyɽܒ£&!?"'(7:hk(~#?.?+ͻO0=>X;!fJ:]k;r^>,>`;0 ]4~#,  4`;0̨`0>0 ~, #~ 7_͕dW <>" \{7\N0 zed <>7z<06 <<> ;063<(2 <<6;0" <"( <7<( << "d;7<( 0>>0 ~#>^>>)`ҥ; ( IH+2*k,*`k*kͺ<ͫ4#>:;+( *^k;> 0>8Y"`k~,bI #~## "^k#> Dͣ=|<=7x7ɷZ7/dN0.id0!*lz> =} 0>?}?>(>~#?!e N0>( G:hk<(=2hkx(?2hk?~#" ?>?>?~# +PYHMN#F+x ##^#V#!e8,P~ > ĒB~( #͒ > ̒rfM~(3BB88B 8!8: 8-@dܭB~ #~(W(S+>:" ͦB#~" #/ͭBBͭB~###~ͦB#0'$0# > # ~#͑C(ͭBͦB~ ĦB#(d0(_~#(T([(/(1R7="=<|Gͣ=ã=|(z7z}kb )70)؇0 [=#~ ( ( (з~í>~+>,>7~# ( ( (+"dk*k"bk*fk|̖>>~>~L>0@#~##("fk#L> K40'_>WN#F>>!>e !*k"fk*fk*fkY*fk|~#fo7 >SJ[bI>bI`33bI33MH4hClC( ( _^#^#V#/dYPN^#V# ^#V####^#V/d P1R>O R>H>&ͦBͦB>>͛d-P~#ͦB~ AoCg^#VO!*D͵C8# !gG͵C0x@ ~~#0~#(7 ( <>O~#d(( 07CG7GFFFRFCF9F F FFEEEeEJEIEDDtDbDXD4D0D/D*DONORITE RITIDTHILENAITAIARPTA&SSINPPER%N$YPROROFHEA#AYSTEWATRIP(TRINGTR"TOTEQ!PPACE IGEEK SEqEEK REpEEK RANoEEK PREnEEK NEXmEEK KElAVUSE~#fo!e8 +ͶI( ͶI  >~[((ͶI[(((]( )(8 # +ͶIȸ >*k#~#(#;>#be+ͨI þ>ͨI#~#Y #T]#ͶI >8 8%"(##~"ȷ +>"###~0(8  ######## JrIͶI0((>86#6#6,>0*k#(( L ͉J͘H# n>L ͉Jʟn>L͟ ͉Jn>2L*k# >72nk;0>0~, 0>0 >0>0 >gH%>y7_aI{ZշĊH:nk ;32LOUN~N}IGHT|ETURESUME ESUMžESTORŽESEԼENUͻEκE͹EAĸANDOMIZŷUԵRINT RINԳOOKŲEEUTUԱPTIOΰPEίN ERROR GO TO έCT{OE׬EXԫAMŪOKSKIKDIzIDERGŨEMORAySEԧPRINԦPOOWEROG1OOOCkOOAĥLISԤISԣINŢEԡEEFTxIL̠NNSTwNPUTvNPUT NPUԞNP'NNKEYuMƝIMEEXtO TϜO SU›EԚROҙIINDsILEӘIELėETCH REjETCH RANiETCH KEYhX RROҖRRRASŕRQO NēLSŒDIԑISPLAIҐI͏EL KEgELETŎEFSTҍEFSNnjEF SENjEFINԊEFDB̉EƈECrATV V V $KͣZz<ʟ*kzͲ>H+ :qkG͠L!qk~w2LͦG*k*k#"kCe*k+^e*k !e8Z L_ LW(5 L_ LW~#(#~#fo!e(0KKK^#V+~#+(K*k6#6#"k{3 N#F*k[e"k*ks#r#s#r#z( Lw#"klM;,>>>,>##>K>͠L0Eog*k#*k 8e'eKw#8"k~lMw#z {3Ͳ>!fJ0G8B( >2qk>(0 0!M(= !M"ok76 .>0>8%>!M"okM2M0>##~SNREATOONԆOMMO΅LOSńLEA҃INHRHAI΂DBAĹUFFERASUTπTSNLDD KEeDD REfB> = < < = 2qk2ik*kw#w#w#"k:ikGrI2ikͶI V+^+###^#V6#s#r<>7ͻO~ #G7MͦG͋?<>((! H2HL[Ys#r#s#r#[eH *kCex[e!CeYgH0> %>͊H KHH"jk8e"lk8| ͦG*lkDM*jk2H#^#V(*]I>!e0 #fI#HH+++>2ikw#s#r>H *k#N#F+x##~#fo!e? *k#N#F#x(0 >%>!xM"ok<2M>%>A >ͦGI>͒>͒͒*k#*k8e}͒|͒lM͒+| *ok"okM M x_!MX!Y!lMAcorn ComputerslM>2qkM M Y!X!x_!MlM>:qk  N <>,&(d8#d7$N~& ͛O/dË ~#.<>d8~.#rkN. ^OQd N >>8[dO_<>%(#[d(!7 Wd7#!rkcOid0 Bb8Wd8O z ({)A_d{'0ԝc> Ë <>#-++<>#d8d0(x0y(}o(|g}o  cM~,d M>, ͗c|SMx,d`Sy`SG(>, _x( O>, !k> 6#6S#= >S> s#rMS>(j>)^#VͩS͕d̨`ed!l^#V+####k~؇Ʃ_kW> M4͛dc"k!9"k!9 ,>8>(ͫ4s#r#(0>8>)"k> (=(=( =( !9DMGT*k*k*k>gT}TgTV>S>0>> 2k,>r9U!Tdde,>0T,TTT;>j͕d( fP-\6 *l4*l~rp\r>:kO =0/d8#{[dQdO0 {dz{8> /<ƀ_x00 8΀Ƀ0>ր<>#!k +w w!kA^bk)))_]|s# ѷ(w <>& 1#<>dH(O #<>O/d0z8PY O&o0O0_X"=80yxd8 dA?00/d Pe͝aoP#YPid~#(d8.8 rd8w+6!id(6#fP~ #ɯ"k͍aW!k6"kyR͜PQX{R!R+R>Rz+6%z8P!P{JQAy( =_QybQ Q{P ACQx(XGPvQbQQ0XRGQ :k(<2<8r{G> z>>( >)z0_^=>>;*l~(uj2kF#~#fo͙U0^,>8;(, L>(jx(͙U0>2kxęUrͶ`_ x8 UV8 z   !(!&(\( \( (:k ͌dyA*l8^p\(*l U7/V:k ygPe7&+ (#$.(#(9( $$.$(#. *((# ( $ $.$yO͐V|U..(,( # $ yO,#(^ # # # #x8Gy@Oxy->(+>O,>89j͕d( ͥky(_xGMQ( #~. #61rdE1R{>+0_>-1R{/ 0_y1R{:1RvQQ0͊QıQ:k.xGog+yNw {G/<0G+60  Oog~6"k5ԣQ+61y+ ~4960G{og w# 60# *k+~#0 +  6"k]R0z>$+w]R0*kw#6"kz:k8Gz >* > +w zWx-8z7+  zx͟RxO0+w0+w 0 #rkG+  70W7WX~'w# 06!rkz y͛dck}'Ơ@YP-\p\ >"zp\>"z(;(,»U>>,z̚r(j!_We!fJr2dN0<> >Random number seed ? ~( >j>)͎b(TW*!e"k!l"k͎b ͐Wc!kͲd+~!kw*kW*kWe "k0l "k!k8dDMkb>lX>X>X>e))070 0))0"k"k#"k2k!!lZMX8>>c`ͲdÈ`ͨ`o_ÛdK]RbK]RX>(jͣd0> o_G>)yZ>(j>,ͣd>)yZy͛dx/V0 x ygPo_fP~# y`[e͈`7ͫ4͌d>_xOF#~#fox0HG]x[e]> Ͱ^&Ͱ^OͰ^xo_H^~8G8C>)~x0~`Ͷ` O[e͈`>(ͫ4͌d_>, G^K>)>x (%~o_<8yOx=##fogGy8xO[e>(>,*l G~)>, _ͨ`,d?_,de_>`È`^>82lÈ*k0 DM*k r+s*k*k8e"k *kyoxg"k͞Y ʹY Al :k "kDMPe+!e?*k8e"k*kDMx8*kY*k+͞Y^e*kY*k͞Y[e*k*k*k*k *k*kCe*k "k*k "k*k "k*k "k*k "k*k "k*k "k*k{ozg*k|صDM*kT] ʹY"kx^e"k*k|DM*kT] ʹY"k#x[e+"k*kDMx*kY*kͩY[e*k|صDM*kY*kͩY+^e*k*k8e*kCe*k*k+x^e"k{3*k"k"k*k#x[e+"k"k!"k"k"k"k"k"k*k"k>Z6*k/<ȅo>g"k*`>( O>,j>)͕d(e_?_AOe_G x`(y͈`ͨ`(+ͨ`,d_^r[dNs  ͗cz{ >(j͕d(e_o_O>,>,*l>)yͫ_,dHͶ`o`x8--}_WxGy}<8 # (  |<`ê9~#N#F`*k'e*k'e++]`t`*ll!e]`È`*l~(#^#V*k!e0*k!e0 k!e ``~`N#~#fox[e!lw#w#w#!k"k>2l*k"ll!e lt`"k͌d*lͶ`x`*k!e X"kF#~#fo*k+++!e "kx`͈`%[!lw#s#kog"k:k[:kZtX*k"k/O:[a:[ *k*k !e"k#*kl[tX}O|G+^e v[a*k!e*k*k8e ,>, 0>a:k2k*k~, *k0>0, z(0:gW0>0,z W*g0> %>YyX*k a 2k:g*kDM*k*gyX#J\~">(7#J\~#J\O~(!(,(#de!lp#s#r͈`( +~ d(ͨ`͒ ͕\͕\A[ ͕\d*l~`ͨ`<=ʈ`bew#~*l `ͨ`HͶ`x\y\È`O[eͨ`HͶ`xy( x(  r͕d ͨ`a|[qc*k"k!"l*k"lSa*l|(V+^+N*k +^es#r!k*k!e(~#N#Fua#uaê9*k'e*l'e"l`i"lydv(<"l!lc!l<c0<89Uc)Ë c0=8%Uc)c0 =8Uc+cڻ=/"l:l  Ucc-[eʂ Ë ͤcL=8(!qcͤcS=8  ͤc|g{oͤczg{ͤc|g{͗c|/g}/o"l͎byd0 ͦ="lqcT/yd8>/ò=y͛dydx0 ̈́cͼb×c H(&x)H(x0 ()Þd`(k(ydde:lb_dx (y~#fo2ll[e (>.6:l>>!lN#:l:l:l?!l~0*lO#͕d  :l2ll:lOZͲd!l:lO[e!lN#.Ë dA?[d.70?:a{ F#1Y!*."!Y"UNLIST Version 1.1 :] ]UNLIST modifies a BBC BASIC program so that it can be RUN but cannot be LISTed or CONVERTed to ASCII. This modification cannot be reversed! Its options are as follows: UNLIST Prints this description. UNLIST filename Modifies filename.BBC so that it cannot be LISTed. The original file is renamed filename.BAK. Note that the same restrictions apply to UNLIST as to RENUMBER; that ###( ~#foO~(# 7y|}|}G}_|WxG}o|gxg}O|G|W}o|gz8G+q#]T{'Ë !"l"l"l͎boog"l>2ll[e (>.6:l>>!lN#:l:l:l?!l~0*lO#͕d  :l2ll:lOZͲd!l:lO[e!lN#.Ë dA?[d.70?:a{ F#is, the program must not use calculated line numbers in GOTO, GOSUB or RESTORE statements.!\$!~e!x x(SGxx!xw#H> ́*s#r#"[R8Insufficient memoryǯ*w#w2h2| 0x(%͞xOxG͗y͞x͞Gx͞կ͞>͞>͞ͽͭe!{Wl!\e!xu!{^e!~u!x^BBCBAK$$$~W_zW!Y^#V#z(B >m< Close errore>mEnd of file - abortͭe>m1y ! !" CONVERT Version 2.0 :] ’ CONVERT converts between BBC BASIC internal format (.BBC ) and ASCII (.BAS). Its options are as follows: CONVERT Prints this description. CONVERT filename.BBC Converts from BBC BASIC internal format to ASCII. CONVERT filename.BAS Converts from ASCII to BBC BASIC internal format.  !\$; e!(m6<File not found>m>m6<Directory full\>\>>mOF\!N  ~ ˹qN! w ˹q~>͞~#_>my͞x͞Gx͞կ͞>͞>͞ͽͭe!{Wl!\e!xu!{^e!~u!x^BBCBAK$$$~W_zW!Y^#V#z(B >m< Close errore>mEnd of file - abortͭe>m g(1 Sorry - file protected> ǯ > > ! ` !9 F ͚ ( (( > w#(X !9 ͬ|[ " 7R 9 9 R } } | !9 ~ ~#  Line too long - abort/ ** Line number added ** * # ** Line number out of sequence ** ɀANDABSACSADVALASCASNATNAUTOBGETBPUTCOLOURCOLORCALLCHAINCHR$CLEARCLOSECLGCLSCOSCOUNTDATADEGDEFDELETEDIVDIMDRAWENDPROCENDENVELOPEELSEEVALERLERROREOFEORERREXPEXTFORFALSEFNGOTOGET$GETGOSUBGCOLHIMEMINPUTIFINKEY$INKEYINTINSTR(LISTLINELOADLOMEMLOCALLEFT$(LENLETLOGLNMID$(MODEMODMOVENEXTNEWNOTOLDONOFFOROPENINOPENOUTOPENUPOSCLIPRINTPAGEPTRPIPLOTPOINT(PROCPOSPUTRETURNREPEATREPORTREADREMRUNRADRESTORERIGHT$(RNDRENUMBERSTEPSAVESGNSINSQRSPCSTR$STRING$(SOUNDSTOPTANTHENTOTAB(TRACETIMETRUEUNTILUSRVDUVALVPOSWIDTHHIMEMLOMEMPAGEPTRTIME ~ #!4~F#(#~(#~ #~.((8~ +x́> ͚ (" JC ͕)> > !4 ~# ~( 'R<0=( x()T]))7!~0:#)T]))_~$%(0:?A[?_{?~ (uA(*(?  8-0)@% (~,(a(ˡͬ|ķˁ6( (G(C(((( ( ( (&(: " ?0˩8#͚ G͚ W˲xGo͚ W˲xg6#zG{Tw#{?@w#z?@w# >͏ < Close error͇ >͏  End of file - abort͇ >͏ Disk full\>͏ 6< File not found >͏ >͏ 6< Directory full>͏ OF \!9 N  ~ ˹qN ! w # ˹q~>  ~# _>͏ 0˩8#͚ G͚ W˲xGo͚ W˲xg6#zG{Tw#{?@w#z?@w# >͏ < Close error͇ >͏ur blank discs in drive B. Before you choose which items of software to make you can ask for help and get a brief description of the purpose of each. To go back to the A> prompt at any time type CTRL C ͕T Z80 pack software Utilities and Graphics Nucleus definitions Memoplan Nucleus parameter file Fileplan Nucleus reporter Graphplan Accountant Basic Accountant Data Disc Cobol Start of Day You can make program discs of as many of these items as you like. We recomme1!F*"!"T Preparing program discs Program discs are working copies of the software you get in your Z80 pack. The software is stored on the seven discs in your pack. You should use these seven masters only to make your working copies. There are twelve items of software on the seven discs. You can choose to make as many (or as few) as you like. The PREPARE program you are now running helps you make the discs for these twelve items of software. You will be asked which items you wnd that you should make a utilities program disc regardless of which of the other eleven program discs you choose. Each of these twelve needs one blank disc, which will become your program disc. You will need to have ready: - your seven master discs - a set of blank discs - a set of disc labels ͕T choose which working copies to make - A Utilities and Graphics G Nucleus definitions B Memoplan H Nucleus parameter file C Fileplan I Nucleus reporter D Graphplan J Accountant E Basicish to make. After you make your choice the program will ask you to place a blank disc in drive B. You will then be asked if you want to format it - answer Y if you have not formatted your disc already. You are then asked if you want to copy the CP/M system. Answer Y to make your disc a CP/M system disc. The program asks for different master discs to be placed in drive A when required. The master discs supplied in the Z80 pack are numbered accordingly. Remember the master discs always go in drive A and yo K Accountant Data Disc F Cobol L Start of Day other options - M Make working copies of Everything N Get help on the options available O Return to CP/M &ĺ͙ړؐm3\T Do you want to return to CP/M T T EVERYTHING To make program discs of everything you will require twelve blank discs. If this number is unavailable please return to the main menu and make program discs individually. ͻ͋͠ړؐ͠INGDOM BBCBIORTHM BBCBPART2 BBCT CIS Cobol!+#T CIS Cobol@FORMS2 COMCOBOL COMCOBOL I01COBOL I02COBOL I03COBOL I04COBOL MSGCONFIG COMPI CBLSTOCK1 CBLSTOCK2 CBLCALL ASMCALL HEXCALL PRNFILEMARKCOM$ANIM V45FORMS2 I51FORMS2 I52FORMS2 I53FORMS2 CH1FORMS2 CH2FORMS2 GN1FORMS2 GN2FORMS2 H01FORMS2 H02FORMS2 H03FORMS2 H04FORMS2 I01FORMS2 I02FORMS2 W01FORMS2 W02RUNA COMT Accountant Data Disc!#T Accountant Data Disc\ͬm͗3T You now have Program discs for all applications Please put your master discs in a safe place. ÕT Accountant!#T Accountant@COSUBS BASCOMPMENUDATSYMENU 01 DSMENU DATDPMENU DATDNMENU DATMENU BASDAYCASH BASDAYCASH2BASDAYCASH3BASDAYCASHPBASDAYCRED BASDAYCREDPBASDAYCRIN BASDAYCRIN2BASDAYCRIN3BASDAYI BASDAYICNI1BASDAYICNI2BASDAYICNI3BASDAYMEND BASDAYMISC BASDAYMISC2BASDAYMISC3BASDAYMISC4BASDAYMISCPBASDAYNLUP BASDAYNLUP2BASDAYPARAMBASDAY@NLMAST 01DNLMAST 01KNLTRAN 01DNLTRAN 01KNLFORM 01DNLFORM 01KPLPARAM 01DPLPARAM 01KSLPARAM 01DSLPARAM 01KNLTABLE 01DNLTABLE 01KDBVAT 01DDBVAT 01KPLVAT 01DPLVAT 01KSLVAT 01DSLVAT 01KDBTABLE 01DDBTABLE 01KT FilePlan!#T FilePlan@DP00 OVLDP1500 OVLDP1515 OVLDP1530 OVLDP1540 OVLDP1550 OVLDP1580 OVLDP1590 OVLDP1710 OVLDP1712 OVLDP1713 OVLDP1780 OVLDP2100 OVLDP2200 OVLDP2300 OVLDP2400 OVLDP2500 OVLDP3000 OVLDPDBUF OVLDPFPLVATBASDAYPRT BASDAYSLVATBASNLBUDGE BASNLENQ BASNLFORMATBASNLFORMUPBASNLJNL BASNLJNL2 BASNLMFUP BASNLPRINT BASNLTB BASNLTL BASCOMPACT BATCOMPACT SUBDAREL1 0 T Basic!#ŌT Basic@MALLARD COMPBASIC COMBBCBASICCOMMALLARD COMMERGE BBCSORT BBCREADDFS BBC6502-Z80BBCVERIFY BBCWELCOME BBCPHOTO BBCPOEM BBCMESSAGE BBCPHONE BBCINDEX BBCKEYBD BBCSKETCH BBCCALC BBCALPHA BBCBATBALL BBCMUSIC BBCCLOCK BBCPATTERN BBCKLSH OVLDPGDFN OVLDPGETW OVLDPI OVLDPLOPT OVLDPSRPT OVLLNEAR OVLQCLS OVLRDINPT OVLSRCH OVLERROR FILFPSETUP FILINFO FILFILE COMFILE1 COMFPSETUP BAKT GraphPlan!Œ#T GraphPlan@GPPBAR OVLGPMENU FILTABLE DIRGPPRINT OVLGPFORM OVLGPSHOW OVLGPSTAT OVLGPSET OVLGRAPH1 COMGPLOGIC OVLGPCHTOPTOVLGPERROR FILCHART DIRPRINTER SETGPSERIALNUMGPSETUP FILGPRINT OVLGPPPIE OVLGPSPIE OVLGRAPH COMPRINTER COMGPSBAR OVLGPHELP FILT MemoPGEN BASAMR1GEN2BASAMR2GEN BASAMR3GEN BASAMR3GEN2BASAMR5GEN BASAMR5GEN2BASAMR6GEN BASAMR6GEN2BASAMMERGE BASAMLINE1 BASAMR1BSE BASAMR2BSE BASAMR3BSE BASAMR5BSE BASAMR6BSE BASAMSOBSE BASCOMPACT BATCOMPACT SUBNRREL1 0 NDMENU DATAMTEMP2 01 AMFOR1 BAST Start of Day!#T Start of Day@MALLARD COMCOSUBS BASCOMPACT COMCOMPACT BASCMPARAMSCOMCMPARAMSBASCOREL1 080START COMCOMPACT R80T CP/M Utilities!#T CP/M Utilities@UNLIST COMCONVERT COMCRC COMCRCKlan!#T MemoPlan@MEMO OVLMEMO COMMEMOHELPTXTMEMOP COMMPP OVLRECOVER COMCONFIG COMCONFIG DATACTIONS DEFT Nucleus Definitions!#T Nucleus Definitions@COSUBS BASCOMPMENUDATSYMENU 01 NDMENU DATMENU BASAMDESC BASAMFDCRE BASAMFDCRE2BASAMFDPRT BASAMFDPRT2BASAMI BASAMLKCRE BASAMLPARM BASAMSDCRE BASAMUPCRE BASAMUPCRE2BASAMUPCRE3BASAMUPCRE4BASAMUPMENUBASAMFIGEN BASAMUPGEN BASAMUPGEN2BASAMMERGE BASAMFIBSE BASAMLINE1 BASAMREVERSBASAMUPLISTCRCCOPY COMFORMAT COMVERIFY COMTERM COMSTAR COMDDT COMSTAT COMED COMXSUB COMASM COMSUBMIT COMDDBBC0 PRLSYSGEN COMPIP COMDUMP COMLOAD COMDIP COMDDBBC1 PRLASSIGN SYSGSX SYSDDFXHR8 PRLDDFXLR8 PRLDDFXLR7 PRLGENGRAF COMDDOKI84 PRLMOVCPM COM'ͪ~#ͼz T completed. Please remove it from drive B and label it carefully. ÕT Z80 pack software Help To find out more, type one of these letters - A Utilities aBSE BASCOMPACT BATCOMPACT SUBNDREL1 0 AMTEMP 01 NRMENU DATAMTEMP2 01 T Nucleus Parameter File!r#T Nucleus Parameter File@AMPARAM 01KAMPARAM 01DNPREL1 0 T Nucleus Reporter!ʖ#T Nucleus Reporter@COSUBS BASCOMPMENUDATSYMENU 01 NRMENU DATMENU BASAMDESC BASAMLET1 BASAMTEMP 01 AMLPARM BASAMR1CRE BASAMR2CRE BASAMR3CRE BASAMR5CRE BASAMR6CRE BASAMRPCRE BASAMRPCRE2BASAMRPCRE3BASAMRPCRE4BASAMRPCRE5BASAMUPMENUBASAMFOR2 BASAMFOR3 BASAMLET2 BASAMR1nd Graphics B Memoplan C Fileplan D Graphplan E BASIC F COBOL G Accountant H Nucleus I Start of Day J Help on the purpose of the program K making program discs for Everything L Return to the Main Menu .ĺΜ͙Ê^˰: ${ T BBC Z80 Applications Help The master discs supplied with the Z80 pack are valuable and should not be used for day to day work. To protect them this program helps you make program discs from the masters. Keep the mast and the blank disc that is going to be your program disc in drive B. The appropriate files will then be placed on your program disc which you can use in your work. When you have made program discs of all the applications you want, exit to the CP/M system and use the disc of whichever application you wish to run. ÕT Accountant is a simple but flexible accounting system suitable for small companies who have decided to computerise their accounts and book-keeping systems. You can use it to run the whoers safe in case your program discs are accidently damaged. You will then be able to make new program discs. You are advised to make backup copies of your program discs fairly often. ( Use the COPY program on the Utilities disc). This way you will not lose work you have done yourself. You may either make program discs for everything at once, or instead make one at a time. You can use the help facility to see what each program disc does. You need one blank disc for every program disc you make. If you wishle of your accounting system, or just use it for parts of it, such as petty cash, or your cash book. Although designed as a business system Accountant is equally suited to home use. To make it as easy as possible for you to change from a manual system to a computerised system, Accountant has been designed to follow closely the manual process of writing up a sales daybook, purchase daybook and cash book. It has also been designed to allow you to record and analyse information with the minimum of effort an to copy everything at once then you will need to have twelve blank discs. ͕T BBC Z80 Applications Help Whenever you attempt to make a program disc you are asked whether you wish to format a disc. New discs need to be formatted before they are used. WARNING Formatting a disc DESTROYS any data on it so be careful. Details of formatting are in the Z80 User Guide and this should be read before proceeding. ͕T BBC Z80 Applications Help You will then be asked to put particular master discs in drive Ad to help you to do this, a nominal ledger has been included. Special attenation has been given to VAT returns, audit trails, transaction details and data validation, to provide you with the maximum flexibility. ͕T The Accountant system consists of the Accountant disc and the Accountant Data disc. To run Accountant you will also need the Start of Day disc. Refer to the Accountant guide for full details. ÕT BASIC is by far the most popular of microcomputing languages, probably because it's partiBBC Basic is a complete BASIC delelopment system. You can run it by typing BBCBASIC Professional Basic is a 'run-only' system. You can prepare programs using MemoPlan and run them by typing PBASIC Further details will be found in Appendix A of the Professional Basic guide. ÕT CIS COBOL. is the leading microcomputer version of COBOL. This is the language that has proved itself over the last twenty years with commercial applications on large mainframe computers. The CIS COBOL in your Z80cularly easy to learn and use. BBC Basic is the advanced version of BASIC that was developed for the BBC Microcomputer. The BBC Basic in the Z80 pack is slightly different from ordinary BBC Basic , because there are essential hardware differences between the Z80 and the BBC Microcomputer's processor. But the two BASICs are compatible, and the guide to BBC Basic included in the Z80 pack gives details of the differences. BBC Basic includes a Z80 assembler. You can use the DIP utility program to copy files pack includes two useful programming aids: ANIMATOR, an award-winning debugging tool which takes you step by step through your COBOL program on the screen, and FORMS-2, an aid to designing data-entry screens. ͕T Full details of how to prepare and run Cobol Programs will be found in the CIS COBOL with ANIMATOR and FORMS-2 user Guide. Details of the language CIS COBOL itself will be found in CIS COBOL Language Reference Manual. ÕT Everything. will create working copies of all the software included between BBC Microcomputer DFS discs and CP/M discs. Professional Basic is also included on this disc. It runs programs written in a dialect of BASIC similar to those of the industry-standard BASICs developed by Microsoft and Digital Research. These are the dialects most commonly used for business software. You'll be likely to use BBC Basic to write your own software, and Professional Basic to run programs written professionally by others ͕T Before running either Basic put your BASIC disc in drive A in the Z80 pack. It will split up the twelve items of software supplied in the Z80 pack and put them on separate discs. If twelve blank discs are not available then use the other options to copy only the items that you want. ÕT FilePlan. is a personal filing system -- you can think of it as an automated card index, or more grandly as a database management program. You'll be able to use FilePlan to keep, for example: - your address book - a club membership list - stock records. FilePlan is also inrogramming knowledge and the work you do with Nucleus will be fully compatible with the Accountant software. You can use Nucleus to write software exactly tailored to your special interests or business activities: almost any routine and laborious task can be automated. ͕T The main parts of Nucleus are: Nucleus definitions: which sets up the files that will store your data and generates update routines Nucleus Reporter: which consists of Report writer - produces reports in columns taking informationtegrated with memoplan so that you can merge names and addresses etc into letters. ÕT GraphPlan. is a financial modelling program. You enter data on an array of rows and columns -- a spreadsheet -- and GraphPlan then enables you to try out your financial decisions before putting them into practice. You can test options on the screen and watch as the program works out the implications. In addition, you can use GraphPlan to present data about your personal or business finances in the form of graphs an from the files Nucleus definitions has set up Label print - generates such things as name and address labels Document writer - produces printouts such as invoices and statements Letter writer - allows you to create a standard text and merge it with information from you files. ͕T The full Nucleus system consists of the following discs: the Nucleus definitions disc, the Nucleus parameter file disc, and the Nucleus reporter disc. To run Nucleus you will also need the Start of Day disc. Refer to d charts. With GraphPlan, you'll be able to visualise how your finances stand, or the way your business is developing. ÕT MemoPlan. is a word processor. It can handle anything you'd now type, or ask someone else to type. Your words come up on the screen first, so it's easy to make corrections before you have anything printed out. You can also use MemoPlan to prepare and edit computer programs. ÕT Nucleus. is a system generator: It helps you develop your own programs without needing specialist pthe Nucleus guide for full details. ÕT Start of Day is a program which is used at the start of a session with Accountant or Nucleus. It contains the language which these two packages run on and it also sets up the printer and function keys. Place the Start of Day disc in drive A and type START You will see the copyright notices and then you will be asked to enter the date. You should then replace the Start of Day disc with the program disc you are going to use, that is either a Nucleus or Accounta RETURN to return to menu )l 1T(Y/N) ?lY(y( N( n(>ɯ> _~#7 5  A8 [8 a8{8>[Aa&o)^#V|>7T Do you wish to copy the CP/M system onto your program disc >ͼT Copying SystemS>K>!2G>2Ny2M"H >!G:Q( *T FORMAT - Do you wish to format the blank disc in drive B T A¯2FORMPREPCOMT  A!nt disc.ÕT CP/M Utilities. are the various CP/M transient commands useful in managing your discs and files. These include the standard CP/M programs such as: - SYSGEN copies the CP/M operating system - PIP copies files - STAT gives you information about the size of your files and the amount of free space on your discs There are also the following Acorn CP/M utilities - FORMAT prepares new blank discs for use - COPY copies the contents of whole discs - VERIFY checks discs for bad sectors - STAR pro s!"{!"| -CREATE 64RECOVER COMͼ! 6!< 8T FAULT - You are using the WRONG master disc >2&ѧ!!&þwT CHANGE MASTER DISC Replace the master disc now in drive A with master disc :&07T ͻ|T program disc. To make this program disc put a blank disc in drive B ͻR|͞T Copying file 1{ö>2!A>2>2  vides access to the BBC MOS from CP/M - TERM ON/OFF turns the terminal mode on or off - DIP copies files between BBC Microcomputer DFS discs and CP/M discs. Full details in the BBC Basic Guide. ͕T GSX Graphics Details of GSX on the BBC Microcompter will be found in the CP/M with GSX guide. Further details will be provided with GSX application programs (such as DR Graph) or in Digital Research's GSX Programmers Guide. ÕTpress SPACE to continuel T press SPACE when ready to continue (~#7> 7~#72&ͼ<|T FAULT - the program disc in drive B is full This can never occur unless the discs you putting in drive B already have files on them. Make sure you are using blank discs. If you are in doubt format new discs and use these. You will now return to the main menu and may start again. ͕ 2 !>(#GMذࢨA34H`CSp|9PX[ZYj᫇>2a>2`2c2s2t>2r>2v!"@!"D!@"B!"F !F#x:~#!|2i~# :" 2i +}|~#:G:ix."2i+w# +6#!6#@A2n2?*j**|+`!#"0!#"2!>ڌo&͖=}  w~2ͼ56!+W ?_!~7z?ͧ:>͞@w#5!:Ƨ(<ʍ>lD t!9DM* w}=!͐KB>2 w!9DM* w}e!͐Kj>2 w!}%H!"wUnknown command! 3! 3!w^!"w*w*a{ѯg|g}o33"s{*ww*s{*s{6!"w*wg!"w*w|g}o"w>2wL2 w͎>2 w͎>2 wͤ>2 wͤ>2 w͙>2 w͙>2 w>2 w>2 w>2 w!ͲC!2ͲC$|³b1"w* w}͋RP|*w+"w!FͲC* w}!w*w1!ͲC/4!ͲC* w}*w%*ww!"w* w}AGDA* w}i*w+"w#|fPOÃ*w+"w#|ڀRi͋R* w}ʻD1|°W1|ʰ!wͣRø!w!wW1|͋R* w}*w}ͥ0 y0*w+"w| H(8N>2 w͂>2 w͂* w}6>2 w* w}F>2 w!zFB"q{3K: Reverse Search : Not Found/4-"u{!ͦͥ03"s{y0*u{*s{(*w+"w|q*s{6*u{ͦKILLS!FB"q{3K2 w͹>2 w͹>2 @| y03"s{ͥ0*s{*s{6Confirm clearing of document? !"w*a{&|g}o}2a{*y{*d}&++x*d}&++"y{3"{{*j{i53"}{*j{i5-"{>2x{G /i50"q{/i5*q{b1#D.0!G 3K8APoint %l length %l column %u mark %l xA G 3K8APoint %l length %l column %u mark %l   mm ) %  36   [*s}}ͣ&!9DM͐͐k͐w>2 w!9DM>2w*z! s#6͐> :>U>F>U> R>Un!wW1"w!wn*z&wn&T`is#r͐!!9~#fo&*w+"w|҅>2w!9* w}D1|*j{ 5* w}++"o{*o{|P*o{+"o{3++"o{*o{|0R*o{+"o{͋R3"s{G!*s{K*s{63"s{A!*s{K*s{6ÐDü 5  !" ) %  *q}}ͣ[*r}}ͣ [*s}}ͣ&!9DM͐͐k͐G!!!!! !!'!8!D!T!c!o!z!!!!!,E!$9!!!Q!!M!!T!e!E!K!U!g!L!f!P!]!W![!R!!H!B!D!@!C!D!G!C!S;D!:9Z - exit menuUpdate displayHoriz. centerQuote characterLine countDelete to markerMenu on/offPosition reportCopy to markerToggle modeWrite fileGo to markerEnlarge windowRead fileSet marker/5/̀A/i5!"w/4!GMark Set!"w*w}!*Hc%!!!)!9!G!Z!h!w!!* }}E!H!!*]{|[!^!!!!!!,E!$9!!!X!!N!!U!!R!8!M!d!S!c!2!c!T!b!1!b!O!!C!i!Q!h!G!!H*]{|!s!q!P!I!E;D!B9Z - exit menuMove other viewQuery replaceX - eXtra commandsSwitch windowGlobal replaceNext pageTwo windowHelpUnderline on/offOne windowPrint, abortPrintRuler lineClear documentExit editor!"w>2 w!"w!)@| /(/5/KKill region without saving? * w"o{*o{*w"o{|h͋RRCͣRb1"q{*q{*o{ک͋R*w*o{*q{ͻRͣR!"w!FB"q{3K: !9DM!!2!`is#rz#G!"o{!"q{*o{*e}ѯg#*q{|#*q{#"q{+)|*o{s#r*o{͐"o{!"w!9Tab increment : ! !?!|!"w!!!"o{!"q{*q{|Ҭ*q{)|~#fo*o{ʬ*q{#"q{*q{|*q{# )*q{)|*q{#)|~n!"|!"wClear tabstop at !"w*}}͝}2}!j44*}}d*y{|d*y{j44>2n{!"y{G *y{*d}&++{>2w{*y{j44*d}&++"y{*}{6*{{6>2n{*y{*d}&++!d̓T*w+"w#|!4̓T!d̓T!d̓T>: 7*R*P:TOzq#!9DM*w}7*w! 6!! ! ͐I|e! n}l͐! w#w! `is#r͐n}͐n&|g}oun&|g}o|¸!%H͐ ?͐nѯg! s#r`i^#Vr+s~͐n}7͐! 9Please enter a numberPlease enter a number8AKRnars#rs#r͐+s#rrQk d  &: b$ %, ! P!9~#A!9"w**w"j!z*"d!"f!Y"H>2^>2a>2` 29=D(/5/KKill region without saving? * w"o{*o{*w"o{|h͋RRCͣRb1"q{*q{*o{ک͋R*w*o{*q{ͻRͣR!"w!FB"q{3K: Indent Column set to %u* w!" w* w!G!"wNew line length @|1!"]{*zn<!\%HPrinting in progress, Abort? Not currently printing!9DM͐_j"q{*q{w͐|*q{"o{*o{|! ^#Vr+sW1s!w*o{+"o{á͐6*q{w*q{͐_j"o{|*o{g͐_j*q{ k"o{*o{+"o{#|@! ^#Vr+sn&ͬ͐n}b! ^#Vr+sn&3@#|@! ^#Vr+sn&ͬ    !!7!! d%/+   36   [*s}}ͣ&!9DM͐͐k͐R>: Line length set to %u!9DM*w}1*w! 6!! ! ͐I|_! n}f͐! w#w! `is#r͐n}͐n&|g}oun&|g}o|²!%H͐ ?͐nѯg! s#r`i^#Vr+sx͐n}1͐! 9Please enter a numberPlease enter a number8AKRn}b! ^#Vr+sn&3@#|@! ^#Vr+sn&ͬ c G K$ %,    36   [*s}}ͣ&!9DM͐͐k͐F2*w&#}2w*w&##}22w*}w&##}2w*Bw}2w!=!ziJustify !9DMb1* w3"s{!S!!KͬOb1* wbb1|¢!!KͬO!S*s{5|RC! 3!w͋R! 6#6*w|g}o! sJ|D1|!!KͬO!S! ^#Vr+s* wb1"q{*q{|͐|*q{͐! s#r*q{͐"q{! n}o͐r*q{! s#r͋R! ^#Vr+sz!!KͬO!!KDP͐͐͐*q{+"q{#|!!YR}P*wYR*s{5|*s{ 5s *y{*d}&++*y{j44>2n{*y{*w{}A*wG*w"y{*y{*d}&l*d}&"y{*y{*}}~!Á!Ҝ*}}ʖ!Ù!"y{G !"w3"s{D1|¾J|AD1|W1|g}oun&|g}o|2W1|g}oun&|g}o|!W1|g}ovn&$W1ͬ!"q{a!wW1|g}oun&|g}o"q{!wD1|J|*q{|ʶW1|g}oun&|g}o|ʰW1|g}ovn&óW1W1|g}oun&|g}o|W1|g}ovn&W1ͬ&a*s{ *s{ 5*s{6*w*a{ѯg|g}o3! 9! 3!w*w1W1|!S!!JͬO!w|ͣʇJ|͝"o{!w!SW1|! ͬ*o{|K|!w! 3RCKD1|ͣJ|ͣW1|g}oun&|g}o|ͣg}oun&|g}o|ͣ!$! 3RCK-5=AJQY]fjru++)"9# -/  S '  *{s͐"{!9_*q}}ͣ[*r}}ͣ [*s}}ͣ&!9DM͐͐k͐&1<GR>2 w<>2 w<>2 wG>2 wG!ͲC!ͲC!9DM͐R͐|ʕP|ʂ|‚&lD1|’!wR|ʾ!w|ʰþ!w&Õ!R* w&5* w&R!w&3"s{1!*s{K*s{6D1|ͣ1W1|͝1J|ͣ!9DM͐|ʮ!!JDP!!JͬO!!ZDPD1|wJ|ʘ!w"q{!wÞ͖"q{*q{|ʨFX!!JDP!!JͬO!!ZDP,1|!wJ|!w"q{! b>u(*}w&#}2w*}w&##}2w*Aw}2w!8!ziFill !9DMu3`is#r!̓T͐ 5͐6!93"s{P|!w!!KͬO! ͬRCD1|W1|!gä*s{ 5*s{6!9DM!TG!!̓T"s{! 6͋R*s{5|5`i6#6J|CD1|C!!KͬO!S`i^#Vr+s*s{5|S5* wb1"q{*q{|/͐|/*q{͐! s#r*q{͐"q{! n}ʯ͐ò*q{! s#r͋R`i^#Vr+sz!!KͬO!!KDP͐͐͐*q{+"w*q{|!RK͖"q{*q{|ͣ1,1|͝!JDP*q{|K!S*q{|UD1|ͣ’J|ͣ’W1|g}oun&|g}o|ͣ!w!!JͬOD1|ͣ¿J|ͣF0DdF!w!!JͬOD1|ͣ¿J|ͣ $)14 %)3:CH*s{KP*wyn}2z!*s{K*s{63"s{͋R!*s{KP*w  !    #!  !   F_*q}}ͣ[*r}}ͣ [*s}}ͣ&!9DM͐͐k͐q{#|!!YRý! n}͝! sP*s{ 5*s{6/S8A!9Justifying...b1* w3"s{!S!!KͬOb1* wwb1|·!!KͬO!S*s{5|!!KͬO!w! ͬ*wYR*s{5|*s{ 5 *s{ 5*s{6*w*a{ѯg|g}o33"s{͋R!*s{KP*wyn}2z!*s{K*s{63"s{͋R!*s{KP*w ;( +!  -/ <)"2 {s͐"{!9_*q}}ͣ[*r}}ͣ [*s}}ͣ&!9DM͐͐k͐ @*|w&#}2w}2w*|w&##}2w!5!ziOverwrite D1|iJ|i*w*a{ѯg|g}oͬ~*w*a{ѯg|g}o3!G!!̓T"s{ 5*s{6/S8AUnjustifying...!G!!̓T"s{ 5*s{6/S8AFilling...!9DM!"w͋R!!̓T3"s{!!̓T3`is#r*s{5|f!S! n}!!JͬO!w͇|ͣxJ|͝"o{!w!S*s{5|! ͬ*o{|K|ʻ!w! 3RC!Rb1* w.!S!w! n}!!Kͬ Pages %u!FB"q{3K*w+|Q|( !M  >   !   F_*q}}ͣ[*r}}ͣ [*s}}ͣ&!9DM͐͐k͐!9DM*}}#!@!R s)!R 6! 6!2! ! !R n}L!O!I|_!R n}o!r!"! ͜j!! ͞p`is#rz!R n}ʦ!,é!8! ͜j!! ͞p`is#rz!D%H͐n!Uͳl.! ͜j!^.!^̓T! .Y8A*d}&+"{!"{Y*{  0! s*{ 0! s! 6!R n}ʙ!* }}|!g!! !! !* }}ʫ!î!! ! !! !S9Format before printing? Format options 3"s{y0!"o{"q{D1|*w}7*q{*wҐP|F*o{#"o{*o{*zhD1|W1|*q{#"q{!"o{*w}*s{S6|ʍÐ*s{6!"w!9DM!"w3"s{y0! s#r! s#r! s#r! s#r! s#r`is#rD1|P|! ^#Vr+s͐ *z#D1|KW1|K`i^#Vr+s! ~#fo͐ +s#r! 6#6*s{S6||͐! s#r͐! s#r͐ ! s#r! ~#fo͐ s#r*s{ 5*s{6͐͐͐͐͐!G 3K8A! 9Line %u (Page %u, Line %u) Total: Print options : memof.commemop.coma:memof.coma:memop.comCan't call printmemo.p$$memo.t$$-print -o memo.p$$ -chain memo -w -p memo.p$$-chain memo -wmemo.t$$memo.t$$ -o memo.p$$ -chain memo -p memo.p$$memo.t$$ -chain memo-nh -tabs!9DM! ͐7*R^#V#zx2I+V+^+**Pm:I2 wG !9File To Read : Read over current document? New File!9DM!!}2k|!n!$!!}2k|!m!$fi`!"w!7G!̓T|-!B%H5!SGWriting...File write errorFile Written!9DM!"w.`i͜j!`i! !I|˜ÿ`i?S`i.*}}ʴ!÷!^̓TG !9File To Write : !9DM*. l! s#rz!3`is#r! ! s#r>2~y0!  6*$~*&~d*#~*.$n&+P5͏&<$!#~4!͈2#~*.$n&|ڍ!*:~&K*h*d}&++k"*!ȃ*n}*n*:~}!*#~&*"~&*;*6*"á!*#~&*"~&*:~&k;!9DM͐|;*.͐! nss9J\vz7  p  Y  " 1> J   F  36   [*s}}ͣ&!9DM͐͐k͐o?|!  6! ! s#r*$~#͈<'! ^#Vr+s6̓! ! s#r͐! ͐o?͐Җ!  6ß*.&6͐n͐ 5͐6>2~!  n&! 9! ͐o?͐Җ!  6ß*.&6͐n͐ 5͐6>2~!  n&! 95CILfz9J\vz X J1# #>#X 3   J   F  36   [*s}}ͣ&!9DM͐͐k͐!9DM!̓T**~",~**~".~!͈20~!"1~!*. ͞p! s#rzl!}`iw#w>2~!**~͐o?"~|*~"&~**~*&~",~**~".~!͈<>20~͐|W1|**~6 c&<$!#~5*&~+"&~*,~+",~͏&<$!#~4!͈<`iw#w*$~*&~ҘW1|4ØW1|Œ*$~#͈<9*$~*&~d`i6#6ÃW1|ƒ*,~+",~*&~+"&~*.~6 *$~+͈<*$~#͈<*$~*&~ҩ*#~&#*:~&͸'"~|*~<$!#~4!͈: Replace : with : Replacing '%s' with '%s'Confirm Replace?Commands are: All, Exit, No, Test, Yes!9DM͐|S*.͐! nssplacing '%s'     5   ' %0 ' 36   [*s}}ͣ&!9DM͐͐k͐!%H9**~".~*$~"&~*&~|F*#~}F*#~&*:~&K*>2"~*.%n&$n&<$>2#~!͈<*.&6>2~!}!9File read errorNo EOF on read*#~}F*#~&*:~&K*>2"~*.%n&$n&<$>2#~!͈<*.&6>2~!}!9File read errorNo EOF on read77S} &*6KNWZ]fnr 'd06 G   ($M " 1> J   F  36   [*s}}ͣ&!9DM͐͐k͐QS!)@|!̓T'!̓TDo you want help about a specific key? !9DM!"w!̓T|o(!1GͰ`is#ry0D1|¯W1͐yn&ʯ!wPÃD1|*u{ͦ!B%H(!RG͐!̓T!:v]!wD1|W1|W1v]!w*u{ͦ 3K8A!9Key to explain: No help for key!9DM͐|ڬ!!P!yͣ`is#r!|Ғ͐S! v]! ~#fos#r͐> ¼>>>> >>>(> >3> >>>>!/>>@>n%>P>1>`>m=>pÀ!n!<À!!<À!m!<À!!<À!9DM!"w!+ s! s!(! !͐|ʻ!þ!I|ï! n}ʟ!(!+ !!I|ï3`is#r! 6T!! !̓T|ʚ͐|~! n}TG!+ ! !G 3K2 w>2a{{2z{2z{2z*d}&++"y{>2w{3"j{3"h{3"l{>2n{! 6! 6!!̓T`i6#6͐͐m! ~#fo͐)~#fon}-! ~#fo͐)~#fo#n&k}p`i^#Vr+s͐!! ~#fo͐)~#fo͞p"z|!!z*zo?|z"]{*zna! n}a!&ͦ|"!+Y!9DM!"w!̓T| !! 6! n}[!(! ! !*I|X*u{ͦ!&y0!"{"q{!Y*q{*d}&++++ң!! !̓T|ʣ!w,1|·W1|!wo!w͋R*q{#"q{"{!"{CZ*q{j44W1`is#r!wW1|W1|y!"o{*o{yn͐P*o{!?P*o{#"o{*o{!?y*o{!̓T!:v]D1| W1|ʠW1v]!wyo*q{|ҿ! !<G^D1|![G^* }&Y*e}&+*q{#"q{!%Z*q{j4|!0%H"!Aͦ!̓T!Fͦ|[! ~#fo͐)~#fo.!̓T|[! 6! 6`i^#Vr+s$!!̓T!!K͞p`is#rzҲ!!U͞p`is#rzҲ>2}>2}͐n ! n}!aG!!H!yͣ}2z}>2z!9[Type any character to continue.] mainmainToo many buffersmainmainMEMOF.COMA:MEMOF.COMNew Filen ! n}!a# #&!    &!  Z E36   [*s}}ͣ&!9DM͐͐k͐43K*q{*y{G 8A*u{ͦ!*9Help about : Help about '%s' not available.Others not displayed, try being more selective.%*y%0x%(-%)%0xY*e}&+*q{#"q{!%Z*q{j443K*q{*y{G 8A*u{ͦ!*9Help about : Help about '%s' not available.Others not displayed, try being more selective.%*y%0x%(-%)%0xERX[k{ ( H    $%  Z E36   [*s}}ͣ&!9DM͐͐k͐!9DM!!!!#h! s#rz>!i!{n!! !͐!̓T!N!|!͐!̓T! n}œ*||ʜ*||ʜ*||¬!i!{n!!}!͐!̓T!! }*|͐!̓T!!:}*|͐!̓T!!T}*|͐!̓T!!0 !͐!̓T*}|g!! *}͐!̓Ty!$ 6$#6m!. 6#6͐$͐?͐E͐0͐2͐.͉͐.͉"z!!u͐͐!̓T!!u͐#͐!̓T!!"1~>27~!"2!!9Insufficient memory.memo.swpCan't open the swap file.Swap file is invalid, please run RECOVER.!9DM!͐͐n|!`i͐o?|!i!{n͐͐`i~n!9Read error in Database file. n!9Read error in Database file. )1@RUYars#rs#r͐+s#rrQk!  & H B"! &!  Z E36   [*s}}ͣ&!9DM͐͐k͐!v͐##͐!̓T!!v͐###͐!̓T͐n*h}}b* }&+*h}ѯg#e!}2 }!P!^|*i}&͝``iw#w͐*d}ѯgҲ͐{*e}s`i^#Vr+sÆ!"{"{!"{!"{"{!"{!G9config.datCan't open data base file. Invalid configuration file. !9DM͐͐͐##͐͐s#rs#rs#r͐+s#rrQkS!#    &!  Z E36   [*s}}ͣ&!9DM͐͐k͐-"u{!ͦ|!!Y|5!%H!!ͦ!.!̓T|„!.!̓T|„*u{ͦ!!%H!!HELPHELPToo many buffersHELPMEMOHELP.TXTA:MEMOHELP.TXTHELPHelp text not availableany buffersHELPMEMOHELP.TXTA:MEMOHELP.TXTHELPHelp text not available $*26<?CLPTX`fimu{y*o{!̓T!:v]D1| W1|ʠW1v]!wyo*q{|ҿ! !<G^D1|![G^* }&Y*e}&+*q{#"q{!%Z*q{j4!9DM!"~*~|Z*~)̅!hs#rzZ*~6*~*~s*~#"~*~|t!#%Z!!8`is#r!!!͐#h"~|ҫ!A%Z!!͐͞p"~{2~{2~{2~! !8~*~o?! ?*8~} ![%Z!>28~!!*~n! !8~*~o?*:~&'kZ~".!!͍>2"~>2~*. $>2~! "~ƒ"*!!**~'kZ~ ~n**~s*~+"~*"*d}&++k"*!ȃ*6*"43K*q{*y{G 8A*u{ͦ!*9Help about : Help about '%s' not available.Others not displayed, try being more selective.%*y%0x%(-%)%0xY*e}&+*q{#"q{!%Z*q{j443K*q{*y{G 8A*u{ͦ!*9Help about : Help about '%s' not available.Others not displayed, try being more selective.%*y%0x%(-%)%0xERX[k{        $%  Z E36   [*s}}ͣ&!9DM͐͐k͐. . Acorn DFS to CP/M file transfer utility ". (c) R.T.Russell, 03-02-1984 : ( 7 b2''141"Acorn DFS to CP/M file transfer utility"141"Acorn DFS to CP/M file transfer utility"' <: F buffer &7FFF P : &85::': Z: (d "Enter DFS drive/filename:"dfs$' )n "Enter CP/M drive/filename:"cpm$' #x cpm$,".")=0 cpm$=cpm$+".DFS" 1 (cpm$) "File "cpm$" already exists."':  &86: "INFO "+dfs$ : 11:A%=135: X=1 39:X,);:A$=A$+((&FFF4)256): ':size=("&"+A$,29,6)) = size>&8000 "Sorry, file too big for this method."': "*LOAD "+dfs$+" "+~buffer * "SAVE "+cpm$+" "+~buffer+"+"+~size  r= drive/filename:"dfs$' )n "Enter CP/M drive/filename:"cpm$' #x cpm$,".")=0 cpm$=cpm$+".DFS" 1 (cpm$) "File "cpm$" already exists."':  &86: "INFO "+dfs$ : 11:A%=135: X=1 39:X,);:A$=A$+((&FFF4)256): ':size=("&"+A$,29,6 ."Enter file type (program/data):"type$' type=(type$)&5F ! type<>68 type<>80 11,11  type=68 type=80 :  type=80 program data #0  "; , program *6 #fin<>13 "Not a BASIC program"': @ Jnhi=#fin FT nhi<&80 nlo=#fin:ll=#fin:#fin,l$ nhi=&FF:nlo=&FF:ll=0:l$="" +^ l$,1)=" " l$=l$,2):ll=ll-1: D^A 2h nhi<&80 ll<>(l$)+4 "** Bad program **"' &r #fout,ll: #fout,nlo: #fout,nhi | nhi<&80 #fout,l$  #fin nhi>&7F  #fin binary  ;  binary F%=fin:G%=fout #G%,#F%:#F%  ;  data F%=fin:G%=fout  T%=#F% D T%=&40 i T%=&FF r T%=0 s "** Bad data **"':#G%,T% #F%  ; & i #0A%=#F%:B%=#F%:C%=#F%:D%=#F% #:#G%,D%:#G%,C%:#G%,B%:#G%,A% D#G%,0 N X; b r +lA%=#F%:B%=#F%:C%=#F%:D%=#F%:E%=#F% ?v E%=0 E%=1 "** Underflow **"':A%=0:B%=0:C%=0:D%=0:E%=1 -#G%,A%:#G%,B%:#G%,C%:#G%,D%:#G%,E%-1  ;  s  s$ S%=#F% ! S% N%=13 . PROGRAM TO CONVERT 6502 BBCBASIC FORMAT FILE ,. INTO Z80 INTERNAL BINARY FORMAT FILE. . R.T.RUSSELL, 04-02-1984 (: 2 7 < ':&85::': \F''141"6502 format to Z80 format converter"'141"6502 format to Z80 format converter"'' P: Z "d"6502-format file:"infile$' ,n infile$,".")=0 infile$=infile$+".DFS" xfin=(infile$) ) fin=0 "File "infile$" not found"' fin<>0 : ""Z80-format file:"outfile$' fout=(outfile$) " fout=0 "Directory full"': : S%:s$=(#F%)+s$: $ s$,13) "** Bad string **"' #G%,s$  ((22<<FFPPZZddnnxx i T%=&FF r T%=0 s "** Bad data **"':#G%,T% #F%  ; & i #0A%=#F%:B%=#F%:C%=#F%:D%=#F% #:#G%,D%:#G%,C%:#G%,B%:#G%,A% D#G%,0 N X; b r +lA%=#F%:B%=#F%:C%=#F%:D%=#F%:E%=#F% ?v E%=0 E%=1 "** Underflow **"':A%=0:B%=0:C%=0:D%=0:E%=1 -#G%,A%:#G%,B%:#G%,C%:#G%,D%:#G%,E%-1  ;  s  s$ S%=#F% ! S% N%=1.ww#w#w#w*>?@͌>w#͌5> w#@ͧ͵g 2q&0OxG͵j/ʆSx\͞.7:77!a{  ʨ ʨ0:?ŷO !y$ 7o&))T])))!y 2p_ :pd error in Database file. n!9Read error in Database file. )1@RUYars#rs#r͐+s#rrQkr bp {uq w{ÖüH!K]jU 2͵ ^#V#*~#fo^#*~#fo^#V#*n^#*n^#V# ~#fo^#& ~#fo!+!#!+!#!+!+}|z{|}|z7||7zZZ)|/g}/o#|͉k|/g}/o#ɯ2hZZk:h|/g}/o#|/g}/o#:h<2hqDM!xxGyO҃)v|͔`i|)Öxڷz/W{/_ѯzW{_=yOxGæ2hZZ͉M|}ȯ|g}o)|/g}/o!  & H B"! &!  Z E36   [*s}}ͣ&!9DM͐͐k͐OMA:MEMOF.COMNew FileGORi(.4Sl%(,259?BFJMQY]ag ,}ѯg_!"{!`%H*{*{ `*{*{:`*{*g}ѯg*{*f}ѯg*n}&͝`*{"{*{"{*{*{ʐ`*{|g}o*{|!i! i!5 iMemoPlan, Copyright (c) 1982 Chang Laborato#z/W{/_!9~#fo! ! ! ! ! ! P!9~#A!9"w**w"j!z*"d!"f!Y"H>2^>2a>2`2c>2s2t>2r>2v!"@!"D!@"B!"F !F#x:~#!|2i~# :" 2i +}|~#:G:ix."2i+w# +6#!6#@A2n2?*j**|+`"d!"f!!>ڌo&͖=}  w~2ʸͼ56!+W ?_!~7z?ͧ:>͞@w#5ries Inc. Serial number: 0000000000000000000000000 MemoPlan, Copyright (c) 1982 by Mark of the Unicorn, Inc. !9DM͸wU|‹ !{n͐͐!̓T Y8A*d}&++"{!"{Y!{n>2 w* w} 'Y| 3K2wS \YG !F G!"o{*o{*d}&++> *o{j44*o{#"o{ !"{!9DM* }&Y.!z*d}&++! %ZCZ*{"_{*y{*d}&++Ҥ *e}&+*y{! %Z>2b{!9%*y%0xMemoPlan V1.30 (%s) %s%*y%0x%(-%)! !9DM!Y*1~! s#͐#j4 5&͐ |E͐|E͐ S6|E͐"{! w#w`i^#Vr+s 'Y|z͐j4͜5|z͐j44͐j44'Y|¶>2n{͐ |ʶ*l{4͐|ʶ͐ "{*{ü!9*w{}*}}*y{+*y{*d}*y{+++*}ѯg?d!!9DM3`is#r͐|ʑ#"o{*o{b1*e}ѯg#"o{*o{|kR|=*o{|ҋ*o{*e}ѯg?1Î͋R"o{*o{|ڰR*o{+"o{×R|!w*j{4!w*h{4>2n{͐ 5͐6!9!9DMr*j{5|# *n{}& *l{5|& 3! s#r*j{ 5*h{͜5|b ,1|b ͐ 5*j{ 5͐*w{}u *y{| *d}&++*w{}ʙ *}}ʓ !Ö !Ý *y{# `is#r͐5| 'Y| ͐ 5͐6͐ ͐"1~! 'Y|z *y{*d}&++z *}{ 5*n{! s#6*x{}2n{!*w{}8 *d}&++; *y{*w{}K *y{#\ *}}Y !\ ! *n{}2x{͐}2n{*{{ 5͐ 5͐6͐"1~͖L*}}ʮ 'Y|® !̓T͐"{b1*e}ѯg"{Z!9!9DM! 6#6͐`is#r͐͐ Q'Y|>2z!?!w!x~n`i6#6͐|U͐/|I͐/̓T`i^#Vr+s$*z}j!!zi!z_j+z6G !9 Line !9DM! n&!(!z͐u! s#r! n&! !z͐u! s#r! n&!!w͐u! s#r! n&!! w͐u! s#r! n&!!{͐u! s#r! n& !?!|͐u! s#r!9DM͐`is#r! n}ʩ͐! s#r͐! s#r͐ ͐͐~n͐͐ !9*$~*&~͏&}!o<$!#~4!͈2n{͐ͥ4*$~#"$~*(~#"(~*,~*.~"(~ !{"\|*{`ʡ&*(~~*\|`#"\|͢:{2{82&ʡ*(~~ ʡ͢:{o:e}ڡ*(~~*\|w#"\|o&v]`e7*T}DM*R]*P><{#*P|/g}/o{# x#7*T}DM*R]*P +><{#+*P|/g}/o#!{+ x:0}D!>*4}+*\:4}2_^G:7}G:8}\!^|f|!^|:0}ʄ!*2}+*:2}2_^G:6}o&Ng^o:h}ʷ: }ʷ}ø} !&*{^& M:J}!*L}+*:N}2_^G:Q}6|͐i5͐5|e*"~͐n}H͐##~#fo*$~ge*&~*$~g&͐!9DM͐ |{*͐ *&~*$~ k`is#r9*.~͐".~*&~͐"&~*.&6>20~*#~*.$n&+͐! s#r! ~#fo͐s#r*&~|*.$n&|͏&! s#r*#~! s#6! w#w͐|c&! s#r*#~&+! s#r*.%n*#~ѯgW+)4~#fo! s#r&*d}&++k"*!*n*"~}͐͐͐*;*"Ø*#~&*:~&K*>2"~*"~! s#6G:R}:L}2bya>28~>27~ |*!"~*~|W*~)~~#fon*~#"~0!9DM͐n}ʏ͐_j|ҏ͐8|ʗ!&Ü!8"~! s*~|¼!&Ü!*~͸'" ~|!&Ü! n&'kZ~"0͐*0͜j*0 6*0`is#r!"~*~|:`i^#Vr+s6*~#"~&*0$6*0&6!!* ~*0;!!* ~! n&k;>27~!&Ü!9!9DM͐8"~*~|͐n}!&*~ͩ#!&!9DM͐8`is`in*#~! s#6*$~! s#r*$~*&~N͏&|N͏&! s#r*#~&#! s#r! w#w&*d}&++k"*!*n*"~}*##~#fo*$~*##~#fo*$~͐*##~#fo͐s#r͐͐͐*;*"e͐<$͐}2#~͈͐<͐ |"͐ g*!Ͱ9!9!9DM*,~*.~X!,|X9*,~#",~+! ns*&~#"&~*$~#"$~*1~|ڰ! n} –!"1~ð*1~! n&*1~^"1~*.&s{20~&*d}&++k"*!*n*"~}*##~#fo*$~}͐n}`in*:~}%!&n`in&'kZ~$n}P!`in&K*%`in&'kZ~6>27~!&n!9!9DM͐+|*$~*&~ښ*(~n} ­!"1~*1~|*1~*(~n&*1~^"1~*$~#"$~*&~*(~#"(~*,~*.~"(~*$~+"$~ !"1~*$~͐`is#r*#~&|=!͐j`is#r͐|a͐*&~a͈͐<&͐*&~*.$n&+*#~&–*&~͈<`i~#fo*&~s#r͏&<$!#~4!͈<c&<$!#~5*&~͈<͐|͐w!9!9DM͐S*##^#Vr+s*"!Ͱ9!9DM͐8! s! n}c͐n}c! n*:~}k!&ã>2~͐S6! s{ʍ͐i53! s#r*:~! s`i6͐5|q*"~͐n}͐##~#fo*$~! s#r*&~*$~! s#r9*.~! s#r&! n&ͩ#*&~! s#r͐ |‚*$~*$~!K!N!,|o*&~! s#rÂ! n&ͩ#`i6q͐ ͐ k! s#r9͐ *,~͐~n*&~͐ "&~*,~͐ ",~>20~*.&6&*d}&++k"*!B*͐)̅~#fo͐o?!?Q#!#%H͐)̅~#fo6!~#͐n*"~}i#>20~͐͐ͺ8!~#! 9Swap write errorSwap Write Error!9DM*$~*#~&*"~&*.;! n&'kZ~ $! n}2:~*:~&'kZ~".!"1~!9DM͐n&<$͐#n}2#~͐##~#fo͈2~`in&ã! 9!9DMD1|! %H *(~n! n}*(~! ns>20~*.&6!Ͱ9!wInvalid BChange!9DM*"~}X *3~##*&~s#r*3~*,~**~s#r*3~*0~s*~+"~*~|ڥ *~n&n}ʘ *~n&)̅~#fon}¥ &*~+"~_ *~|һ *7~}» !~#*~! s#r*{`is#r*{! s#r`8͐|!! "~ƒ"*!5*3~~#fo",~*,~*&~".~&*~`in&!ͣ" ~* ~!!~n`in}2!9!9DM*~! n&!ͣ"~*~Ғ%*~J&&! s#r͐! ns*{`is#r*{! s#r`8! n&&27~i#͐n! s#6͐)̅~#fon&'kZ~"0*0%n! s#6*0$n&͐n&͐$ͣ"~͐)̅~#fo#*~|Z"!l"͐*~+$n&s͐)̅~#fo*~*0$n&+™"!ë"͐*~#$n&s͐)̅~#fo6͐n&&27~`in&2*!9Swap file full!!9DM! n&'kZ~%n! nѯgW`is#r*~͐$n&!ͣ" ~* ~*~Ү** ~6͐"~*~$n&++" ~* ~;~n* ~|g}o}/o|/g|g}os*~͐n}ʮ/͐n`is! `in&!/ͣ|G/`in&|G/`in}K/`i6-`in}:b/͐+|b/`i6-`in}.‚/! n}|/`i6-Â/! 6*. ! ^#Vr+s`ins! ^#Vr+s.*. ͐6!9<>,;=?*[] *:~&k!9DM*.͐n&!9DM`iw#w&*.%n*#~ѯgW+"~*~*.%nѯgc0`i~#fo*~)4~#fos#r*~+"~)0͐*$~p0!9*.%n&$n&<$>2#~!͈27~!9!9DM*#~&#*:~&͸'`is#rz,,!Å-͐`%)̅~#fo"5~͐*5~**~͐~n*.%n*#~ѯgW#)4*5~##*5~͐s#rs#rs#r*5~6**~͐",~**~".~>20~͐"&~&*d}&++k"*!R-*n*"$n&<$*.$n&+}2#~*&~#͈w&!! n&*(~<|=3!3!9&"*n}4*"3*!ȃ,4!\4%Hȃ"*$~*#~&*"~&*;**:~s*No more marks!9DM͐k!9DM͐kn&!9DM͐k6!9DM͐6!9DM*$~*#~&*"~&͐;͐ZSwapping...*(~*.~ 9&*(~*,~s9*.~*,~*(~".~*,~*(~*.~*(~~n*(~",~*.~"(~é9*(~*.~*,~*.~~n*,~*(~*.~",~*(~".~>20~!9DM*y{|9͐*y{*}}9!9!:*y{*d}&++:͐*d}&++*y{#:!9DM͐kn*:~}9:;͐k`is#r&͐k"*͐ڋ:*n*"~}ʋ:*"a:&*͐*;͐k"*͐:*n*:~}:*S6|:*"î:*͐k*:~s!9DM͐n}(5!\5%H͐n*:~}K5͐n&ͩ#͐ $!"1~Invalid mark!9DM!`i͐ ~n͐ 4`i 5!9!9DM͐n*"~}͝5͐##~#fo*$~͝!9DM͐n}5͐n*:~}6!?6%H!͐n*"~}'6*$~͐##~#foͩ*#~͐#nѯgWͩMark in wrong buff!!9DM͐n}x6͐n*:~}ʅ6!6%H!͐n*"~}«6*$~͐##~#foͩ*#~͐#nѯgWͩMark in wrong buff!!9DM͐6!9DM&͐|ҧ7͐s1p>B2 Are you sure you want to format the disc in drive :ͫ ? Type Y or N>!͸NʐY >2 Formatting track :A22k2S2`2t!k>>2y2Z2g( !>w+(w+>w+yw+ !S>:_(.(Formatting errorDisc write protected͕!`>:j(Verify error yPڴ2:kژ>!w#!w#:2t5:t2t5 Formatting complete{(> _(~#ī ̩ >ͫ: ! 8 ,$.  G>0ͫ>0ͫ>0ͫ|&}.:=1> 2!t >:~Disc faultc*_*iK":}&2<Ç.&.:<.>&y72<*<~T.;I.O+I. 9.x+~I.+.:<*<~ʅ.;z.O+z. l.x+~z.^.&y72<*<~T.;I.O+I. 9.x+~I.+.[ !:gi\i!R!6C#6O#6Mi~# RiiWrite Error.$No Directory Space.$--------------------------------------------------- GENGRAF 1.0 15 Nov 82 Serial No 5000-0884-654321 Copyright (C) 1982 Digital Research, Inc. All Rights Reserved --------------------------------------------------- $8!O>!A~i1(/0GG#~0## @# ;S V> + F> #^=*"C! 6P#6R#6Lx*"5! x* A7 *"* " !{OzG~# x~#a{ w# #iNot enough memory$GSX SYS O**}|g."Ow# y˜DҴxw#z ¬ç*,O!"~! 6##6>2! 6i~*@_;:;#> C.;>C=^#;Cѷq : unexpected EOF$ not found$ASSIGN SYS !e6C#6O#6M\#*})))))))}/o|/g#"2|!\i$R! 6$#6$#6$Oi6Y: !2 6=21 á:1 : r+s#r==_HL"4 " >6 ͪS* "6 =23 :1 =21 v=O* #" Y8  ͝҉* +"8 .!2 ʞR̀* "4 4 = ͝* #" çR*6 DM+R*8 DM+R*: DM+R*< M!? q=  ͝Kd*= ! ͸p!@ 6>!@ X*= }O!< *@ & w*= #"= !@ 4)!< 4\mad* }O!< :? wlR*4 DM+{R* DM+R 4 ͝*4 }¿= 4 ͝< N*4 #"4  å;*4 DM+: Y2*B("zK*+!>w>ww###!v(##K"\8-fCP/M DIRECTORY FULL$EXTRA BYTES AT END$[\[!"[R8\\8CP/M FILE NOT FOUND$6 !SS[\ [!"*"!~(r! "6 !!N~qw(* KB8PNOT A BASIC PROGRAM$#*R("zK##"*K ">!͆: _͆08X40T! w͆. I͆(D=(@! w͆. 5͆(0=(,!w!6#͆(=( ( w5~A 0O> :A 0:A AO>&R̀:A A H.2B !2 w:B !D s+q*C &͍:D _og_{ozg^#V) _{ozgi`N#Fogo&og_{_z#Wq=  ͝Kd*= ! ͸p!@ 6>!@ X*= }O!< *@ & w*= #"= !@ 4)!< 4\mad* }O!< :? wlR*4 DM+{R* DM+R 4 ͝*4 }¿= 4 ͝< N*4 #"4  å;*4 DM+: Y2 6 7INVALID DFS FILE NAME$!6͆(x=(t!]wO͆(g=(c: +yA8]Q0Y@+w͆(P=(L.(H!]w͆(<=(8 (4.(#w5~ %!d6͆(=( (#w5~ 7INVALID CP/M FILE NAME$ âw#w#w͖~Ժ#~(ĺ /"#?0:?2?U:..x 2?*#?"?x5~ 7INVALID CP/M FILE NAME$ âw#w#w͖~Ժ#~(ĺ /"#?##"*K ">!͆: _͆08X40T! w͆. I͆(D=(@! w͆. 5͆(0=(,!w!6#͆(=( ( w5~1w(CͰDFS Interface Program$Ariadne Software Ltd. - February 1984$'*>O ͢wİG͐xx   >!\w!hw#!w#> !] w#>!w#w#w#w: ͤ= i* *= [ͤ(h͐(c/ J͆B +#RI N͐(I0 8!&&&&ݶw_INVALID FORMAT$!~º! ">!! "["!~T! ~ J#"~ EFNpw###~# ( q###w# (~#KB8J#@ COPYRIGHT (C) 1978, DIGITAL RESEARCH ERROR: $, LOAD ADDRESS $DISK READ$INVERTED LOAD ADDRESS$DISK WRITE$LOAD ADDRESS $ERROR ADDRESS $BYTES READ:$INVALID HEX DIGIT$CHECK SUM ERROR $FIRST ADDRESS $LAST ADDRESS $BYTES READ $RECORDS WRITTEN $HEXCANNOT OPEN SOURCE$COMNO MORE DIRECTORY SPACE$CANNOT CLOSE FILE$*!9"!e !" !" \!""͊: ƒde"\\\͊: ²d\͝: )d;! q* &f  ! q> ! : A O: 0O! q: O: O! p+q* |O* }O! p+q*  f! p+q* DMB! p+q)R* DMB1B* DM+;! p+q* i2 ! p+q* i2 ! p+q* i2 i2 !" p+q*! f!$ p+q*# i!& p+q*% i!( p+q*' i2 !* p+q*) f!/ s+p+q+p+q:/ =2/ X*+ *- w*+ #"+ *- #"- 1* #" ͖r*   ~!" ! ͸×* " x20 º*   DM":0 Ad*   6!" Ç!" : !"6 "8 ": }2< !"4 "= ! 2*">!b!ͯ >!`0ͯ !q:E:24J!46*}a!44EJ *KM^'́:‚ͯ !36'n::0:f9OY#9.3'ͳ.:020' 'ͳ'7 6'!j>A+!s!"@͓1!"<**"͓n "Dn"":!Q2҂:X!Wғä:ڤ*MEÓ:ұ@@:O2Mc;!6#6>!)*&P ~"::H:H:H:H"!6!4:_jYO jM*"S*" 3@bl*M1͓!""7 *M^͆ \͔!":͎H*#"ͧÝ/ :>͛9ͯ .*#":_!' !'6!36' :1/!aE*#">z?C9IͲÁ.!6> !ڇ*&' ~2 ʀ: y.*M!4Q>!қ:=2á:2:Ҭ\>!ҿ:=2K:2K!:!:K\: \!p+q͈*!9"1W͜Q>2!͢QG}DrYQ|͏}͏#> ex͏#r* _> e> e ҉0Ë7e}} :³ʳ7_<2!~ɯ2|\\FILE DUMP VERSION 1.4$ NO INPUT FILE PRESENT ON DISK$!Y , <    *$A!6 # T!w $r# *`: 0 *A*! ~ ʰxkb))))_y‘BK{ͅ*!66!"80*{#z+++ #DM!  ::=H-\:N2O_og_{ozg^#V))) _{ozg^#V) d^#V|g}o n_{ozgO{ozgi`N#Fogo&og H ©=¨' !'6!36' :1/!aE*#">z?C9IͲÁ.!6> !ڇ*&' ~2 ʀ: y.*M!4Q>!қ:=2á:2:Ҭ\>!ҿ:=2K:2K!:!:K\: \!p+q͈*ȟ/H:_2:!q:A/>Z!/H8: 2::=O>m:W!Q} Hmd>9>!6:2*M!E ^#V͎ڗO **~2*#"m2m͖ 2m!6m!6m!6 m2mͯ m!62m!62m!62m!62m'2:2:TҒ:2!6*ME:2::^Ҳ:<22ý: 2:} >ͯ :i:2:d*M:[ ÷:S:QHI:N<22: H@"2Í202O> c!6Í202O> ڍ*&O*& !sc*&P :w:·>!ұͯ :22:_!6=!6>'!E!4!p+q*0 !r+s+p+q*~$7*>*>H&>*#"*#"> 2:^R͎:!6!6=2:ʙ!6:“H9Ž>!6-e!6ͻ2=2ʺ-é:>>"ͻ2:!!5ͻ2ͬ!\*M:>!(:=2%> >>!F!5+N! ~2!4<2T>>!b}*bMͭz!b~26!~6<+wé>!`ҥ*`MͭҞ!`6!6> :é:(!q:!wO! ~2*& :w>!:!4!6>:N<2N!> *N& N2 !p+q!6!6+6 !6: S: M!6g8:N2M*M8p!6!6!6>!ڕ*&P 6!4z!6!6#6#6!6*M8:ھ:*͇g2ê::¿::,͡A<2O>-:>>!p+q:,!6*DM9:<!6:z 2W!6D*&L :w:<2Ov*:>=20O> ڒ:0:AO>Ҥ::A }}Hͬ!wͻO`idͻV[2O>2:!X!6:!:=O!L NE!4 E E:/.*&L 6$L9k9.Xͯ *KM^020 :020:121'ͳ':²ͯ !G6!"!"7 *M^n/ :a/:H!6:ͯ !&6*M8):[ͱ!N5!6ñ:5!6#6>!ڰ!6:<2O>/:!O!T *M͡H~K:¡!6[–ͱ!N5:2:2!4=:[¼ͱ4:!6:.2O8: :* ͇g:[ ͱ!N5!6:%:<2*6 * 6å!q!6> !d*&I :]>!4A>:<2O* :w:?†!6!q!6?!:ҠgÐ!q*&*~!6:22: :]Hں:A2O>: 2ͯ 221@:2!o6+6+6!6#6!6#6:G*o .!N6:^*M^!K6!6!6+6' :$::=2K  :ʤ\:ҷ\x'Ͳ:!\͢  :͈'! Ͳ:$: $͈Ͳ!N6' :!Cwͯ !6:^͢c!6{:/>!/H{ͯ :<2Š ::=HҮͯ !6:Ҿ:2 !6::/H͈;!6:> !/> "}*}DM͆ ' ͯ *"!z4 :e !"͆ !z6:|!z '? 2*H#"H!{6:{ր!Ң *{& :{4 2!{4m *":ڹ ͯ !z4I '2!"!q: !4>!S :S! :2*M! ^#V͎ * :w*#" = = = = = ͯ  *M !6q  !6q  !q  *& !6à  !6 à  !60à  *& !6  !6  !6  *& . 1 4 7 : = F P [ f q  HHͯ :!^w:<2:0}:@E}:!S!W6: z!]6:cm!c6:_z!_6l ::,: HHҰͯ : 2ó:E:1:2v!q!*8!*6: >ͦ>ͦ!q:_  !p+q.*   !q*&!p+q*2!p+q*2!p+q*22!p+q*!p+q*!p+q*!p+q*2!p+q* :2!q: " *M n :c4 *M n :2!c:Q !c:2: !:cw>!n !5 Y : { !6!q:!lwҙ  â :0O !q:O| :O| !6:]2l:o'2o:n'2n:m'2m*mMͣ *nMͣ *oMͣ :]:   *}2D" * * *&"!q:UY: Y:ҩ: ʩ:_2ʘ:€!6<:<2!ژ!6 >!]Ҥ; !6:Q::H: !6*M : !6!q:a/>z!!p+q* !q*& *M *M !p+q*!!p+q*"!p+q*$!6  !kp+q*j> >ڪ Þ !qp+q/ *pDM9: :M2r:N!r !:r *r& N!r4 !6:͔: :ͳ.!ws+p+q+p+q:w=2wN *s*u w*s#"s*u#"u' !"*M^7 !x6:!xھ **DM͆ 2yʭ :yʗ ͯ *"*6:2x÷ *"!x4d !"/ !j}=2| !"*KM^'_ !z6:|!z1 *( Disc fault Disc write protected= (> _~#K I pS!` S' S" S*S*S"K"`!K& K" K*K*Acorn CPCPMDISC/M  0(INP:/OUT:SPACE)(INP:/OUT:SPACE)(INP:/OUT:SPACE)(INP:/OUT:SPACE)(INP:/OUT:SPACE)(INP:/OUT:SPACE)(INP:/OUT:SPACE)(INP:/OUT:SPACE)(INP:/OUT:SPACE)(INP:/OUT:SPACE)(INP:/OUT:SPACE)(INP:/OUT:SPACE)(INP:/OUT:SPACE)(INP:/OUT:SPACE)(INP:/OUT:SPACE) COPYRIGHT (C) 1979, DIGITAL RESEARCH, PIP VERS 1.5$$$ SUB =.:,<> _[]INPIRDPTRUR1UR2RDROUTLPTUL1PRNLSTPTPUP1UP2PUNTTYCRTUC1CONNULEOFDISK READ ERROR$DISK WRITE ERROR$VERIFY ERROR$NOT A CHARACTER SINK$READER STOPPING $NOT A CHARACTER SOURCE$/M  0ABORTED$BAD PARAMETER$INVALID USER NUMBER$RECORD TOO LONG$INVALID DIGIT$END OF FILE, CTL-Z?$CHECKSUM ERROR$CORRECT ERROR, TYPE RETURN OR CTL-Z$INVALID FORMAT$HEX$$$$NO DIRECTORY SPACE$NO FILE$COM$START NOT FOUND$QUIT NOT FOUND$CANNOT CLOSE DESTINATION FILE$DESTINATION IS R/O, DELETE (Y/N)?$**NOT DELETED**$$$$$$$NOT FOUND$COPYING -$REQUIRES CP/M 2.0 OR NEWER FOR OPERATION.$UNRECOGNIZED DESTINATION$CANNOT WRITE$INVALID PIP FORMAT$CANNOT READ$INVALID SEPARATOR$1 :2L> ̈́M9  |( Requires CP/M 2.2$}" *RB"!=""j"";!J""C!"="g!"Y""+!"`!"!W"""!"7!""#"!""@!v"'!"\!"5!""""+"{!"!"Z!"""G"-#"]"""[!"l!_"u!"""X"c"g"!""!!C""t!""!H"""!"! """L"^!"U"4!"!""!?"""!Q" !"?!"!|"!"4":!>"=!*sD1x*"!T"!~(N!9"_#6 >!Ϳ!:10w+ 0/0w+00000{=*u:+~ 5 5 00!:͂ 41#6 +͇.&̇.:ʇ.! ȹ0 #> ~͢#Ͳ0 80>.B0!+R"!w(0G:8A ))))o>"*|}0:P M } (w>!!ͤ( Disc fault!!ͧ:(Not a CP/M System disc*"*"S(STAR VERS 1.40$0x0:ڛ0 ¯00O:گ0>0ͯ0y*0w+"05 *00Ow+ 0 (>~!>!*"*"{D!3">! ͋1x:(>~!>*͒! ͋>!*"*"{D> ͒> _:(>~!Escape͟(R(( ( w#x(w>!>!* R~x >*͒+???*> > #~ T]ͅ~*(G("DFS(;Cù (*(O }~ *ͬ}~ >!}2*> ~͢> ~!](&( !~ZSYSGEN VERSION 1.60Z SOURCE DRIVE NAME (OR RETURN TO SKIP) = A8C8&Z INVALID DRIVE NAME (USE A OR B)Z SOURCE ON KZ, THEN TYPE RETURN,A2r!~!s!!!!Z FUNCTION COMPLETE!!p : 2Z DESTINATION DRIVE NAME (OR RETURN TO REBOOT) = A8C8'Z INVALID DRIVE NAME (USE A OR B)Z DESTINATION ON KZ, THEN TYPE RETURN,A2r!!!!!Z FUNCTION COMPLETE:rwsR1Pͤ{R''''w>#+:o&>>~Escape} ( w*~*[: > ~#> ~͢#Ͳ0 80>.B0!+R"!w(0G:8A ))))o>"*|}0:P M } (w>!!ͤ( Disc fault!!ͧ:(Not a CP/M System disc*"*"S(STAR VERS 1.40$0x0:ڛ0 ¯00O:گ0>0ͯ0y*0w+"05 *00Ow+ 0 Ľ y0G G t :):,.>C :|: Jü;r :R: ʼʋ!ʼR!ʼʋ>SR{ozg!~4ʧͦ !6 ! **̈́**̈́\iͩ !w#H USE FACTOR !* "z{*"* "I !" :1 R O*UR X* G:xl :  *̩ : l x͖ *#"EH DH 0:~ ! ^4! w͆ Æ *! 6z͖ {͖ 4>R>V>D >P >L >N-!6]:ͧz2~e:~2O! 6*~& 6$>!~_z*~& w!~5Bx:yͧ*v+"vv ~_{ozg001 $$$$ SUB6ͭ:}"!}5́ͭ́3*yM"h:}^a A2}O>Vͧ^:}>*z& ~ !z4í!{q*v#"v͙dͧ*vv :{w:x<2xO>}|ͧ copyright(c) 1977, digital research $Error On Line $SUBNo 'SUB' File Present$Disk Write Error$Command Buffer Overflow$Command Too Long$Parameter Error$Invalid Control Character$Directory Full$Cannot Close, Read/Only?$!9"!͇͊!p+q* ͊!p+q*͍2!p+q*͍2!p+q*͊!p+q*͍!p+q*͍!p+q*͍2!s+p+q+p+q:=2ʦ** w*#"*#"!p+q(+*DM*p*& 6:ep\:=ͧ!t6>!t%\= >!t6:t<2t=O! ~2u b:<2O>9b!60+~9b!60+4:uat:u_2u:uMʉSͧ!v6!"v!|6:|Ҁ!x6 2}:} Hk:} h:}$6 2}$*}M3:}02}O> ͧ3!z6ͭ:}"!}5́ͭ́3*yM"h:}^a A2}O>Vͧ^:}>*z& ~ !z4í!{q*v#"v͙dͧ*vv :{w:x<2xO>}|ͧ{zA"*![N![ N#Fr+sq#p/>G=#w#w3#w#w!JSYMBOL TABLE OVERFLOW G*##~w*##~͎*_###s#r^#V`à 4 Wm ()*+,-/ABCDEHLMDBDIDSDWEIIFINORSPACIADCADDADIANAANDANICMACMCCMPCPIDAADADDCRDCXENDEQUHLTINRINXJMPLDALXIMODMOVMVINOPNOTORAORGORIOUTPOPPSWRALRARRETRLCRRCRSTSBBSBISETSHLSHRSTASTCSUBSUIXORXRAXRICALLENDMLDAXLHLDPCHLPUSHSHLDSPHLSTAXXCHGXTHLENDIFMACROTITLE  PF FP! ( 2/Ͱ>2lyPLnR>UX:l̅2l͓*>ERʵ2C!" """ :ʼ:*1 |R|ͦ0FIL: R  R* } *" :¿::¿üX!C^#fk[@ :Œ:=ʌG!ʆF#H vÛc*| EH ͺ,^1 ͦ *""1 EH DH ͺ,1 ͦ :  1:  " > 2 ?'  v:P@< !  PP27 ( *"  NZZ NCC POPEP M x_BH!œ#¶ ¦{KÈCÈ<:JCR:  !6 s!#  ɯ<:O=_Z!F!V#fjQ̓E!^#Vo&)~#FxGyѯ<àn8!~ڢͅ6~44O! s#r!~ ڿ6ͅ^4!mw!wp!~ͅ!55N! N#fio&)^#fk:|: |Ë  |*" ͩ !6="1 :  1}1:n:>BʋSSͦSSxS 1:  1"" ͦ 1 |͍ >O U!" 1 1!|_!^#fk $8AP`ixH ñññ81Ľ y0îH ñGîG  ñH ñ(Ľ yîH ñîîĽ y0îîH ñG 1: :,; c*| } 8Oz'{ͅ>ɯo>g"k!m6ů{_zW5>)D*kOxGd !m?FDM!xGyOڂÃ)sn55)=â|g}o=î--#zg{ozg{ozg{oÓ:: ;,!ɯ22=2l!"]!~H5_!m~0:ą:  *":  :‰:̅ԅ!^#=ʅVq”*qͦ1& O:lµ̅>2ly:_!w~!s!m~ùy !~=w_!m~ ͅ!4w_#~ ʸ A:4~~# ¼ > \ ?ʻ w# !ͼ ? !ͼ @2 0 0:x0_<2! wI2 2> 2 >2ɯ22 !~@_6^4#: w~$w: 0 q: A: A͋q: a{_2  2 - !ɯ2I:  ;*:  ͭͷ ͭ͋>9q>9: '!2 >9 7:! 6 >2>2: 2 Qͭ:Ğ! :lj<͖<j<|<: OʊQ>ÖH >2 2 û: B­>ôD> ¸!52 !"!N#~#A07O! ~*!) " !)ͼ !ͼ :5͡ :6:6͡ :7͡ :\ ʻ 24!dͮ 25ͮ 27ͮ 26!8 ( ʃ !Y 1  :7ʞ !z 8  !"2D2X2#! 8 !ͼ z{* ! !"!8 w#  +6# *#"~!ͼ G:6QxJQS*!w#"! 1 !"!Y~~# …¡z!ͼ wʹ* ! w#" ! 8 !" ! zz_O4:  :6y:  '<ͭ'<>V$>O$:Ğà\ÞØ`rÍÖ![w#w#b!"!F#v2[G*##~w*##~<*}q!~ڬ6![^![^#fk"͎͘!G#*####*^#Vû!^*"*:! G~#x=2> > ! >x6 #='G! ~ p( O*}O>4?:7w:#ĸ*"!͸* }w>ͪg( ʆ1 Y :7ʗ8 z !<ͼ CP/M ASSEMBLER - VER 2.0 NO SOURCE FILE PRESENT NO DIRECTORY SPACE SOURCE FILE NAME ERROR SOURCE FILE READ ERROR OUTPUT FILE WRITE ERROR CANNOT CLOSE FILES END OF ASSEMBLY G:7xʘ!#~ʄl͸Ä**!O {zʊ͸*"!!#^4!$wͯͯWƐ'@'ê>:ͪ!#^Ww*!{͚|͚}͚͚{!$~#͚͚> ͪ> ͪ1*" COPYRIGHT(C) 1978, DIGITAL RESEARCH á 4êü /L9ASMPRNHEXL,DE:ADD HL,DE:JR C,ok DPUSH HL:POP IY:LD DE,(spacer):SBC HL,DE:PUSH HL:POP IX:JR newlen 3.ok LD HL,(item):LD BC,4:ADD HL,BC:LD (item),HL :PUSH HL:POP IX:LD DE,(spacer):ADD HL,DE:PUSH HL:POP IY ELD DE,(end):SBC HL,DE:JR C,newlen:LD DE,(spacer):SRL D:LD A,E:RRA 2 &FC:LD E,A: D:LD (spacer),DE:JP NZ,loop:RET =".start W 0:.end W 0:.spacer W 0:.check W 0:.item W 0 ,.error RST &38 *6B 100:M "Bad sort parameters":B 0:] @ pass J: T. Test program: ^: +h "Filling 1000 6-character s" . SHELL SORT ON STRING ARRAYS =. (c) Richard Russell 1982, from an idea by Robin Tracy.  sort 300 2 pass=0 1 <P%=sort F[OPT pass*2 PLD A,(IX):DEC A:JP NZ,error "ZLD A,(IX+1):CP &81:JP NZ,error )dLD L,(IX+2):LD H,(IX+3):LD (start),HL HnDEC HL:LD D,(HL):DEC HL:LD E,(HL):DEC HL:LD A,(HL):DEC A:JP NZ,error ExLD HL,(start):ADD HL,DE:ADD HL,DE:ADD HL,DE:ADD HL,DE:LD (end),HL #SRL D:RR E:LD HL,&FFFF:EX DE,HL :.rotate SRL D:RR E: A:SBC HL,DE:ADD HL,DE:JR C,rotate 8EX DE,HL:ADD HL,HLtrings..." r A$(999) 6| I=0 999:A$(I)="PQRS"+(64+(26))+(64+(26)): % I=0 14: A$(I),;:: "etc..."  "Sorting the strings..." : sort,A$(0) : . Call assembly language sort routine. % I=0 14: A$(I),;:: "etc..."  "Finished." lCortB~=B~Bnf"B+V+^+~=B*B"B:!:R8))"B*B"B"B~8~G(^Vnferror RST &38 *6B 100:M "Bad sort parameters":B 0:] @ pass J: T. Test program: ^: +h "Filling 1000 6-character s:ADD HL,HL:LD (spacer),HL:EX DE,HL K.loop LD IY,(start):PUSH IY:ADD IY,DE:LD (check),IY:POP IX:LD (item),IX @.newlen LD A,(IX):CP (IY):JR C,short:LD A,(IY):.short LD B,A A A:JR Z,null:LD E,(IX+2):LD D,(IX+3):LD L,(IY+2):LD H,(IY+3) F.next LD A,(DE):CP (HL):JR C,ok:JR NZ,swap:INC DE:INC HL:DJNZ next $.null LD A,(IY):CP (IX):JR NC,ok 4.swap PUSH IX:POP HL:PUSH IY:POP DE:LD B,4:.move JLD A,(DE):LD C,A:LD A,(HL):LD (DE),A:LD (HL),C:INC HL:INC DE:DJNZ move @LD DE,(check):PUSH IX:POP HL: A:SBC Hwwwwwwwww11wfwwoooooooooooooo !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ ^"#$%&'()*+,-./0123456789:;\=`?ABCDEFGHIJKLMNOPQRSTUVWXYZ<>~_]abcdefghijklmnopqrstuvwxyz|!]@ K"=z(`&j<|{?0~v!g @@@  @ @  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~IDS12eVT$m5 IDSPSeVT$m 5 Qume935VT$m5  RSDaisyIIVT$m+  ((((((S(((((S((S(UU((((((((UCent737VT$m  CentPSVT$m  Filele`O$mConsole`O'UUUUUUUt tt     t     S(US(((((S(((((S((US(TVI9xx19O  $/C9l/yt=%c%c%[(%:)%]%(E%10z%)%(R%10z%)VT52hZ19P  HJJKY%c%c9 KY KY%c%c%[p%:q%]VT100Z19P#%;<[?6h[?4;7l[?7h[%u;%uH[%[;7%]%[;4%]%[;5%]m[%u;%ur%[%(M%15z%)%:%( %15z%)%]ZenithZ19P !(*x1wy1vY7 EY9 KY KY%c%c%[p%:q%]ProPSeVT$m#H ]PN !"Diablo10VT$m5 Diablo12VT$m5 DiabloPSVT$m5 VanillaVT$m Spin10VT$m5 Spin12VT$m5 SpinPSVT$m5 IDS10eVT$m5 PlaineVT$m EpsoneVT$m#  45Pro10eVT$m #H ]N !"Pro12eVT$m#H ]EN !"Printer OutPrinter 2.2Console InConsole OutHaz15009O %c%cY7 EY9 KY KY%c%c%[p%:q%]HDSC1009P %'CNU7 wH  W %36z%6za%c%c%[D%:d%]%[G%:g%]%[C%:c%]%(%32z%)%(%32z%)HP2621A9O HJJK&a%uy%uCKY KY%c%c%[p%:q%]HP264519O HJJK&a%1g%uc%0g%uYKY%c%c%[p%:q%]bbcthZ19O3 %1g%c%0g%cY9 KY KY%c%c%[p%:q%]AAAmbassadorO #,.JP[%u;%uH[%[;7%]%[;4%]%[;5%]%[;1%]m[%uL[%uMMicroAngelo(S %c%cY7 EY9 KY KY%c%c%[p%:q%]SorocIQ120P  *YT=%c%cY9 KY KY%c%c%[p%:q%]SuperBrainP  Y%c%cY7 EY9 KY KY%c%c%[p%:q%]Teleray1061O  jJJY%c%cY9 KY KY%c%c%[p%:q%]ADDSViewpointP  0P*T=%c%c%[(%:)%]KY%c%c%[p%:q%]ADM31Z19O  ":yT=%c%c%[(%:)%]%(E%)%(R%)%[p%:q%]ADM3AZ19P  =%C%C7 EY9 KY KY%c%c%[p%:q%]Bantam19P KIX%cY%cEY9 KY KY%c%c%[p%:q%]$<LPVT$m#  45 (08@HPX`hpx< ),-A,fillbb  Um͐@!]!;J͐"ݕ!9DM*ߕ͐=!!2!͐!A!;J͐"ߕJ͐"ߕ9rM K*K= ( /  >>. &.1 (%  5! | sKp{!9DM*}0! ZI!"ו͐"ٕ*}`!!!;J!"ݕß*|‡!!!;J!"ݕß!!!;J!"ݕ!9DM͐#|͐ZI*ו*}͐ F*ݕ"ו͐ *ו`is#r͐*ٕ*&I! ~#fo*ߕs#r͐ `is#r*|v͐*|g͐|v͐ *|v͐ a`iw#w͐|ґ! ZI͐ `is#r͐*! ZI`i~#fo*s#rÑ!9!9DM͐>O>>C>>D>>S>!&!&!9DM*ߕ͐_!J!ZI!BZI͐͢I! ZI͐"ߕ!9DM!J!ZI!GZI͐͢I! ZIZI!GZI͐͢I! ZI!)9A`is#r͐|0͐*"ٕ͐|0!! s#r͐ "ו͐*"ٕ͐|}*}W͐͐ #W! ZI͐ `is#r}͐|}!ZI`i~#fo*ݕs#rW͐*ݕڬ! ZI`i~#fo*ݕs#r}͐|!͐!;J͐*! ZI! ~#fo*s#r͐|!!!;J!9!9DM͐>O5>\>SA>c>CM>c>DY>jq!&!&*&!9DM! ZI!"ו͐"ٕ!9DM͐#|͐ZI*ו͐ F"ו͐ *ו`is#r͐*ٕ! s#r͐*! ZI͐{YE! ZI`i~#fo*ߕs#r!9*}T*|T! W! !9DM!͐ @͐ P!;J!;J7n}2'-40͐ 0!T!;J!9DM*ݕ͐!͐@!]!;J͐"ݕ!9DM*ߕ͐=!!2!͐!A!;J͐"ߕJ͐"ߕ9 / O  "" -KR"$ @1=b/  ! '(%  5! | ! ~#fo*s#r͐*C!!!;J͐|a! ZIR͐ `is#r͐*ڐ! ZI`i~#fo*s#ra͐|!!͐{Y!;J`i~#fo!͐{Ys#rÐ͐ "ו͐*"ٕ!9!9DM͐>O>;>C >B>D,>B>S8>BI!&!&!9DM͐"ٕ!"ו!"ߕ! ZI*!9DM͐#|ʨ͐ZI*ו͐ F"ו͐ *ו`is#r͐*ٕ! s#r͐ "ו͐*"ٕ͐|0!͐{Y!͐!A!!2!͐!A!;J!9͐"ߕ!9DM!͐#! !;J!9!9DM*! n}}! n}ʍ!Ð!ZI! n}2ZI! n}2'-40͐ 0!T!;J!9DM*ݕ͐!͐@!]!;J͐"ݕ!9DM*ߕ͐=!!2!͐!A!;J͐"ߕJ͐"ߕ95   (  6 6L2 / 1';;*1= (% 5! | &!9DM͐*ݕ !͐@!]!;J͐"ݕ!9DM͐*ߕ^!͐O!]!;J͐"ߕ!9DM͐*œ!͐+|°!>ó!<!;J͐"!9DM*! n}! n}!!ZI! n}2!9DM*ݕ|ͣI͐XY*ݕ|͝I͐XY*ݕ|ͩ!9DM͐9|͝!9DM͐*ו`is#r͐|‘õ͐"ו͐|<͐XY*ݕ|͐M|<͐|9͐*?|! ZI`i~#fo*ݕ_/2!9DM! ZI!"ו͐"ٕ!9DM͐*ו`is#r͐*ٕ! s#r͐"ו͐*"ٕ͐ #|ʮ͐ ZI`i~#fo*}ʡ! ä*s#r͐|͐!^{Y! s#r!͐ !V!;J! ~#fo͐s#rî͐|҃͐͐8! ZIR͐`is#rÃ͐!^{Y! s#r!͐ !J!;J`i~#fo͐s#r͐*¯! ZI`i~#fo*s#r͐|͐!^{Y! s#r!͐ !H!;J`i~#fo͐*?s#r6!ZI`i~#fo*ݕ*?s#rõ͐XY|\͐M|͐9[͐9`is#r͐|ʵ͐XY͐*?|ҭ!ð! ZI!9!9DM͐*ٕ`is#r͐|0͐*"ٕ͐|0!͐{YE! ZI`i~#fo*ߕs#r!9*}T*|T! W! !9DM!͐ @͐ P!;J!;J7n}2'-40͐ 0!T!;J!9DM*ݕ͐!s#rï!9!9DM͐>O(>O>S4>O>C@>O>DL>V]!&!&!9DM͐"ٕ!"ו!""ߕ"ݕ>2**E!̓!**E!̓!!9DM͐ *ו`is#r͐#|ʤ͐|͐ M|͐XY|9͐XY*G*}G͐XY͐|V!Y!̓͐|g}o|v!y!͐|g}oZI*ו*ݕ*?"ו͐ j͐ ;!9!9DM͐>O>>C>>D>>S>!͐ZI`i~#fo*ݕs#r͐|ʀ͐|L͐!9{Y$T! $! ZI! ~#fo*ߕs#r͐ `is#r ͐|Ҟ! ZIR͐ `is#r͐|͐!{Y! ZI`i~#fo*ݕs#rÞ!9!9DM͐>O>&>S >->C>->D#>4;!&!&!&!9DM! n*}V! n}2!*}q!Xt!Y!;J!9DM*ߕ͐š͐"ߕ! ~#fo)s#r!͐ 0͐ 0!T!;J!9DM*ݕ͐! ! ZI͐ "ו͐*"ٕ!9!9DM͐>OD>k>CP>r>D\>r>Sh>ry!&!&!9DM͐*ݕ”!͐#!!;J͐"ݕ!9DM͐*ߕ!͐#!!;J͐"ߕ!9DM͐* !͐+|!5!!6!;J͐"!9DM*ݕ|ͣ{͐XY*ݕ|͝{͐XY*ݕ|ͩ!9DM*ݕ|ͣʻ͐*ݕ|͝»͐*ݕ|ͩ!9DM͐*ו`is#r͐|d͐"ו͐5|ʑ͐͐@!]!;J͐"ݕ!9DM*ߕ͐=!!2!͐!A!;J͐"ߕJ͐"ߕ9,L 1 > 1 Gk-  s Q =V ( - "!.'e>i(,!9DM͐"ٕ! ZI!"ו!""ߕ"ݕ>2*{*Ͷ!*}g!d*{*Ͷ!*}“!d!9DM͐ *ו`is#r͐#|ʕ͐5|͐ |͐XY|͐XY**}XY*ݕ|#͐|‘͐|ʎ͐*?|i! ZI`i~#fo*ݕ*?s#rË!ZI`i~#fo*ݕ*?s#r#d͐XY|ұ͐|.*ݕ|͐*ݕ|͐*|*! {͐*ݕ:͐*ݕ`is#r*}.!!! ;J͐|d͐XY{͐*?|\!_! ZI!9!9DM͐*ٕ`is#r͐|”͐*"ٕ͐|!y͐{YͶ! ZI`i~#fo*ߕs#rã!9!9DM*ߕ͐͐XY{͐|!!$!*}U͐|g}o|J!M!do͐|g}o|o!ZI͐|g}oZI*ו*ݕ*?"ו͐ Ϳ͐ m!9!9DM͐>O>>C>>D>>S>!&!9DM! ZI!"ו͐"ٕ!"ߕ*!9DM͐#|U͐ZI*ו͐ F"ו͐ *ו`is#r͐*ٕ! s#r͐|!U͐{Y*&IR! ~#fo*ߕs#r͐ `is#r}͐|! ZIR͐ `is#r`i~#fo*s#rz͐*"ٕ!9!9DM͐>O1>X>C=>o>DI>o>SU>ov*}ͣk*}ͣ&!&!9DM! ZI!"ו͐"ٕ!"ߕ>2!=*́!9DM͐ #| ͐ |͝=͐ |! 6 #6͐ ZI*ו͐ F"ו͐*ו`is#r͐*ٕ! s#r͐"ו͐*"ٕ͐|ʐ!1͐{Ý! ZI! ~#fo*ߕs#r͐`is#rH͐|ҫ! ZI͐`is#r*}>*|>͐*|>!͐ 0͐  0d 0͐0!F!;J!9`iw#w͐|O!=͐*~`i~#fo*s#r! ZIO͐|*}ʧ!ZI͐0ZI!͐ 0͐ 0!0!0!S!;J!9`i^#Vr+s!|!ZI!9!9DM͐>O$>K>C0>R>D<>R>SH>RY!&!&!9DM! ZI!"ו͐"ٕ!"ߕ"ݕ**$!9DM͐ *ו`is#r͐*ٕ! s#r͐ "ו͐*"ٕ͐#| ͐|͐!{Y?Bx [!9DM*}0! ZI!"ו͐"ٕ!9DM͐#|o͐ZI*ו͐ F"ו͐ *ו`is#r͐*ٕ! s#r͐|D͐|*&IR! ~#fo*s#r͐ `is#rD*}*}͐͐ #! ZIR͐ `is#rD*}D͐|D!ZI`i~#fo*s#r*}ʢ͐͐*Ң! ZI! ~#fo*͐͐*s#rL! ~#fo*s#rz*&I͐ `is#râ`i~#fo*s#rz! ZI͐ " 2:+&b!\&*O|b!O!l&!9~#foHb> +ͩb#~6b##*bxSrbZb aEXECL: Too much text $!pb!*w#~b*:1˜b*áb!¡b!a{ ѷ! !\/:l25!b>W Extended Submit Vers 2.0Xsub Already Present$Requires CP/M Version 2.0 or later$:y*###ƒ# yk   җ 4!~=ŐW!xʵ ~#èbx {~#o}où.xsubb!np+q*m2_!pp+q*o ]xsub*"-!/"*"+!""1 M*!"́!"* (xsub active)$|*y ʥ*"*7***x*́͋<͛ :%*=26͋!7^#6 #6 #6$ 8*7~O #w# !6:6=2% ͋*-"*$$$ SUBq:(=2(N *$*& w*$#"$*&#"&' !"N*M^7 !)6:!)ھ *N*DM͆ 2*ʭ :*ʗ ͯ *N"P*6:2)÷ *N"N!) $@BA$! A "!$"" ]xsub*"-!/"*"+!""1 M*!"́!"* (xsub active)$|*y ʥ*"*7***x*́͋<͛ :%*=26͋!7^#6 #6 #6$ 8*7~O #w# !6:6=!9DM͐͐Y͐#Y͐!9DM! n&n]|ͣTY! n&?]|ͣ!9DM͐|sY͐wY͐!9DM͐͐ښY͐ÞY͐!9DM`iw#w! ^#Vr+sn}Y`i^#Vr+sðY͐Y!9!h9DM! ^#Vr+s~#fo! s#r͐! s#r! ^#Vr+sn`is{0]`in}%]! ! s#r! 6#6! s! s! s͐n}-oZ! ^#Vr+s! 4͐n}0Z! 4͐n&V}ʜZ! ?^ßZ!! s#r! ^#Vr+sn`is{.Z! ?^! s#r! 4! ^#Vr+sn`is`in&ͳX}D[UO[XX*K/:l2> G_:c):M8_=8_=> G_:lw:co&552:7:K)V>_z>_z2:K,"e!"g*O|*g‹_5*M*e!ѷʼ_2:ʶ_ʶ_!Æ_*gÆ_*O+"O*M"M*g#"g*e! N#Fp+qx{_##6>2:À_2:#7*M^#V#z`x20`+V+^+`*K͸a:0`o&9! 7:K,>G`2:͆`*M:Oz`=]`z`:K)~2#5͆`*M!s#r!^#V7*Kb:l2\5¹`> 2:!*K^7*M*K:OOz`q#`7:K)V>qaz> qaz2[Oa[Cʧ[S[]͐~#fo|O[! ^#Vr+s6-͐͐~#fos#r! ^#Vr+s! 6 g[! 6g[! 6! ~#fo! n&! ^#Vr+s~#fo! ͝]ѯgs#rP\! ^#Vr+s! ^#Vr+s~#fos! ^#Vr+sP\! n}[! 6#6! ^#Vr+s~#fo! s#r͐n}P\͐|P\! ^#Vr+s! ^#Vr+sns! ^#Vr+s! ^#Vr+s\͐6! ! s#r! n}§\! ^#Vr+s!|ڧ\! ^#Vr+s! n}ʞ\!0á\! sl\͐! ^#Vr+sns{\! ^#Vr+sç\! n}]! ^#Vr+s!|]! ^#Vr+s6 :K,"e!"g*O|a*g5*M"M*e"*gGa2:a#"g*O+"O*e! N#Fp+qxa##6>2:a2: 7*+++:KG_*MDM!ao& 2ZYo& 2]\7*K!9/:l2 6C#6O#6M5a*M|bM!\&b!\&*O|b!O!l&!9~#foHb> +ͩb#~6b##*bxSrbZb aEXECL: Too much text $!pb!*w#~b*:1˜b*áb!¡b!a{ ѷ! !\/:l25!b>\]! ^#Vr+s`ins-]! ^#Vr+s`insZ͐6!9!9DM! n&|ͯj]! n&|ͩ!9DM! n&|ͯڙ]! n&|ͩ!9DM͐͐ ]͐^#Vr+s͐]͐0]͐7s!&6^͐ ͐͐ ͉͐͝]`is͐ ͐͐ )͐͝]`in&#&6^!9!9DM`iw#w͐~#fon&V}ʌ^͐ ?͐^#Vr+snѯg`is#rM^͐Ó^!97*O|DM*M*K^><^~# x¿^ ><^~+ x^|}7,^> 2cJO*}ͣ&*}ͣ&*}ͣ&*}ͣ&*}ͣ&* }ͣ&*l͐!`O!9~#fo&!9DM'S! w#w*}ʹOOOOOPP&P 2P GP [PpP! w#wpP! 6#6pP! 6#6! 6#6pP! 6#6! 6#6pP! 6#6pP! 6#6pP! w#w! 6#6pP! 6#6pP! 6#6! 6#6pP! w#w! 6#6pP! 6#6! 6#6pP͐͗S`is#r`i~#fo͐)))s#r`i~#fo~#fo"f`i~#fo##~#fo"h`i~#fo~#fo"j`i~#fo~#fo"l*&I*f͐ !P!9~#fo!9͐͐s#rs#rs#r͐͐~#fo͐)++s#r!9DM͐~#fo͐##~#fo͝!9DM͐##~#fo##͐~#fo͝U͐##~#fo͐~#fo͝U͐~#fo͐~#fo͝!9DM͐##~#fo͐~#foV͐##͐~#fos#r#V͐##^#Vr+s͐s#r!9DM͐~#fo͐~#fofV͐~#fo~#fotV͐~#fo##~#fo!9DM͐~#fo͐~#foںV͐͐~#fos#r~#foV͐^#Vr+s~#fo!9DM͐n}V! ^#Vr+sn&V!9*h!Q!9~#fo*&IJT!9DM*}OQ͐#|OQ͐ n`is#6YQ͐`is#r*j͐ ͐͐͐!~Q! 9~#fo!9!9DM*ە͐¥Q*ە͐|g}o"ە*ە|g}o|Q͐|g}o|Q*&Q*&I*ە|g}o|!R͐|g}o|R*&R*&I*ە |g}o|VR͐ |g}o|LR*&OR*&I*ە@|g}o|ʋR͐@|g}o|ʁR*&ÄR*&I*ە|g}o|R͐|g}o|ʶR*&ùR* &I*ە|g}o|R͐|g}o|R* &R* &I͐"ە!DM! n&|ͯ&W! n&|ͩ!9DM`iw#w! 6#6͐ n! s{ ]W! n} kW! ^#Vr+sAW! n}-ŠW! 6#6! ^#Vr+s! ^#Vr+sn! sV|W͐ ?! nѯg`is#rÊW͐͐?W!9!y9DM! `iY`iV!9!9DM͐`is#r! ^#Vr+s! ^#Vr+sns{AXX͐HX!9!9DM͐`is#r͐n}{X! ^#Vr+scX! ^#Vr+s͐ns! ^#Vr+sn}{X͐êX!9!9DM! n&?]|X! n&X! n&&!9DM! ͐Y9DM*ە`is#r!"ە͐͌Q!9!!\S^"|ZS!!dS^"|ZS!qSuMPP.OVLA:MPP.OVL Can't find the overlay file, MPP.OVL !9DM!͐?*1`|T!!*P_?|T!`i*P_?| T!!Tu`i!UT!9Read error in the overlay file, MPP.OVL *_!9DM͐+! s#r͐ n}T! ~#fo͐ nѯgs#r! ^#Vr+sn}T! ~#fo! ^#Vr+snѯgs#r͐`is#r͐~#fo͐s#rjT!9!9DM͐͐##$E*,d*ѯgͲ!!! !͜^!9Can't find device '%s'; using default. !9DM͐|uE͐}2!" *}–E!V*7"ÜE!"I*hO!CͫN}2!"FQ6I!!9DM͐" !9DM͐**F!9DM* ͐" !9DM͐|4F!CFu*͐"DMoveV: can't move up! * **!9DM*}ʘF! n&FÛF!`is#r͐FG͐F! n&"!9!9DM! n&) ~#fo!9DM͐"GKJ!J͐UOUnInter: %d chars is too many!  *}LK!JDU|†K!J/VͱK|ʆK!JxVL͈K|ƒKÆKLK*}͝«K*A}͝¨K*D}ͣ͝&!9DM͐|K͐|K͐`is#rK`i6#6*I}L L9LôLM&L(M|!L͒M|ͣ}2ҕ*ҕ}ͣ4LM|ͣ&L*ӕ͐|qLM|\L!&L!AN*Օ#"Օ!"ӕ(M|ʘL͒M|˜L*Օ|ژL*Օ+"Օ*Օ|ͩүLM|ͣ&L*I&!LuL!9Invalid synchronization code: '%d'!9DM͐** *"Q**"!"*͌Q!9DM! n}2}LGFH͐|ʤG͐! |¡G͐!OH`iX`i! |¡G`i͐!VHuÿG*zd|ʷG*zdͲ!ÿG!tHu!!0!͜^*I}FH͐|H͐!H`iX`i! |H`i!Hu4H*xd|,H*xdͲ!4H!Hu!!!͜^!9%s OutCan't find port '%s' or '%s'.No default output port defined! %s InCan't find port '%s', required for synchronization.No default input port defined (one is required fo|M͐|M͐AN*ӕ#"ӕ*'}AM**}AM!&*'}VM**&͞arM*'}lM**&zarM**n&*-ѯg|g}o*.&͝&*&}¨M*(&͞aM*&}¾M*(&zaM*(n&*,ѯg|g}o&*A}M*D}M!&*A}N*D&͞a!N*A}N*D&za!N*Dn&*Gѯg|g}o*H&͝&!9DM! n*FѯgW|g}os*@}~N! n&*B&ͫaéN*@}N! n&*B&zaéN*B! ns!9DM͐>N>O>N>O> N>O>@N>&O>N>2O>N>>Or synchronization). !!JT>2ҕ!"ӕ!"ՕKEI!9DM*}yI! n&àI!JjU|ʌI>KyI>K!J! n&U!9DM͐|I͐ ͢I͐ 0ZI!9DM! n}I2J! n&+`is#r͐͢YJ͐n}2J`i^#Vr+sn&ZIJ!9!9DM! `is#r! w#w`i^#Vr+s~#fo#|zJ! ^#Vr+sUJ͐J! `is#r! ^#Vr+szʷJ`i^#Vr+s~#foZIÍJ!9!9DM*}J͐|J͐|J͐!Ku!JjU||g}o"*|g}o|Q;!ͫN|Q;!OͫN|Q;!26>2͈K|R=>K!9DM*͐|g}o|r=*d}ˆ=͐!=W*͐|g}o"The print enhancement "%s" is not available on this printer. *|=*|=*E**"1>!ͫN|#>!SͫN|#>?TA!""!9DM*|D>h?*+k#~#fo*q?! s#r͐+|y>!}>*+! s#r͐! s#r͐|h?͐*h?͐k#~#foE͐k###~#foF͐kn&sF͐k#͐ s#rýA!"!9!9DM͐|9CB"]C͐! |]C͐!-EWB"!!!͜^*}C>2!">2>2>2>2>2{2 {2 {2 {2{2{2{2{2{2{2{2{2{2{2>2!UE! X!H*7"!V*7"!H*7"!V*7"*}ʾD**d*g)Ͳ!!! !͜^**d*g)#Ͳ!!!!͜^`iw#w͐|һD͐) !H͐) ~#fo7s#r`i^#Vr+s|DD`iw#w͐|D͐) *s#r`i^#Vr+sD! F"*}##~#fo|g}o|M?!ͫN|M?!SͫN|M?͐F͐kn&sFF=! ~#fo͐s#rÑ>! 9!9DM!DͫN|ʺ?[F͐XY[F͐XYҺ?!ÿ?!!9DM`iw#w͐*@͐k###~#fo|g}o|@@`i^#Vr+s?͐*"@KA*! s#r͐+k###~#fo|g}o|_@! ^#Vr+s-@͐+k#~#fo͐k#~#foq?! s#r͐+|¦@͐ë@͐+! s#r͐! s#r͐͐KA͐͐KA͐k###~#fo|g}o|x2͐͐! s#r*Rk?|g}o͐! s#r͐͐! s#rF=*Pk! s#r͐*jҵ1͐ ke n}ʧ1͐ ke~#fo͐s#r! ^#Vr+s]1F=*Pk! s#r͐|2͐ ke n}1! ^#Vr+s! ^#Vr+s1F=͐ |u2͐*j+2*Pk! s#r͐ ke n}g2! ^#Vr+s͐ ke^#Vr+s! ^#Vr+s2F=! 9!9DM͐XE!"*}³2!V*7"ù2!"!"!"!"!ͫN|͝}2!"!">2ͨ<<*}3!V**"F!9DM͐ |57*`is#rV7͐ |N7*`is#rV7!:u͐> f7>7>r7>7>~7>7> Š7>7>*–7>7>¢7>ʬ8>®7>9>5º7>9>7>ʠ9>#7>ʠ9(:͐|7͐|7͐! s#r8͐͐! s#r! ~#fo͐s#r͐|_8͐͐|g}oá8͐ڇ8͐͐|g}oá8͐͐|g}o! s#rÌ:͐͐! s#r! ~#fo͐s#r͐͐|g}o!*7ͽ66ͻE!9DM*}@3*! n&5"5*|g}o|4*|g}o|3*|g}o|Œ3*|g}o|ʗ3*}ʗ3! n} 3*|g}o|4! n&'Y|3! n&V}4`i6**))##~#fo3*#"))*s#r4`i6! n&|ڕ4! n&|ҕ4! n} }4*k! ns*k#*s#r*k###*s#r*#"*! n&5"4! n&|g}o|4!~3! n&|g}o34!^3! n&@|g}o3`in}5*))##* s#rÌ:͐͐͐͐͐ ! s#r͐|{9͐͐|g}oÕ9͐͐ |g}o! s#rÌ:͐͐͐͐ ! s#r͐|:͐͐|g}o:͐͐|g}o! s#rÌ:͐Q:͉͐͐! s#rg:͐)͉͐! s#r͐͐|g}o! s#rÌ:͐Ó:!9PUnMica: bad direc?!9DM*͐:͐"*|g}o| ;!OͫN| ;!2d*d}ʄ'Æ*`in&|'`in&|'*! s#r*j#"j+d`ins͐##~#fo`in&5s#ry*`in} ]( f( l(t(ʄ(ʲ(ʲ(ʲ(ʲ(ʲ())))))7)^)ʃ)ʨ)ʱ))*8*;*.͏*y*ʹ2dy*!Vs+ͽ6y***! s#r͐~#fo!Hs+s#ry*,! s#r͐~#fo|g}os#r͐~#fo`in&,|g}os#r*-;-@-E-J-!!!! !!!!!@!!!T-uAttrMask: Unknown attribute?!9DM6*d}Œ-!-V;`is{ʦ-ʦ-ʰ-ø-`in}2dø-!wa*d}-! !9 Insert fresh page; type any character when ready --> !9DM*d*d!..*d}=.*Vk}=.*Rk#6"Rk*j ke*js#r*Vk}^.0=!Y`is#r*j}ʠ.͐ͽ6!.ͨ<͐ͽ6!.ͨ<*j}.͐ͽ6!.ͨ<͐ͽ6!9!9DM`iw#w! w#w͐*jҜy*,! s#r͐~#fo`in&,|g}os#r*y*,! s#r͐6͐w#w*y*>2j,! s#r͐`ins*y*>2j,! s#r͐`ins*y*́,*y*>2Vk*j"Pk!Hs+"Rk!"Tky***! s#r͐ 6͐~#fo! 5s#r*Tk#"Tky***! s#r͐~#fo#6s#ry*y**! s#r*j#"j+d`ins͐##~#fo`in&5s#ry*`in}͝}2d!9!9DM!"j"j͹,`is#r͐n}͝}2j͐n}͝}2j>2Vk*!9>2j*j}a+! *j k/͐ ken! n}R/͐06! n&͐ͥ/F=*d}I/Ü/`iw#wÎ/`i~#fo͐ ke##~#fo͐ ke~#fos#r! ^#Vr+s.!9!9DM͐|$0! n}$0͐+ ke~#fo|g}o|$0͐ ke~#fo|g}o|$0͐ ke~#foͰ:͐ ke~#fo06͐ ke~#foͰ:͐ ke~#fo`is#r͐͐# ke~#foҭ0͐dn&3`i^#Vr+sr0͐ ke~#fo|g}oͰ:!9!9DM*Rk`is#r*Tk! s#r͐|1e*Nk kj͜^*j ke*js#r*j ke##w#w*j kew#w*j#"j>2j*j+ ke!9DMͩͩ`is#r͐Dң+!+u͐͐7õ+!9Invalid mica value in intermediate file. !"Nk{2j{2j!"j*Nk|,!X,uG,! *Nk# kj*Nk kj͜^*Nk#"Nk*Nk kjCharacter attributes nested too deeply. *Nk|Җ,!,u*Nk+"NkAttrPop: stack underflow *Nk kj!9DM! n}---"-'-,-1-6*{+"{*{#"{+! ns!9DM*{#|/*{`is#r! n&*{͐!{`͐|ʍ`i~#fo͐s#r͐!{*{`?͐*{_!"{!"{{"{!9!9DM! n&*{#|!*{_!!9DM͐n&ͳX͐n&ͳX}>!! ^#Vr+sn}d! ^#Vr+sn}i!!9DM͐V;ͳX} ʩYʩʶʶʶNʶ!V!!V!!VYes No Answer 'Y' or 'N' --> !9DM͐ͦ5ͨ<=ͽ6͐)06!-#ͦ5ͨ2dh#! [$* d}v#.* d}ʇ#N'Ï#͑[$!9DM*d#"d<`is#rͨ<<*d*d#*d}#*d!Q$W#*d}#*d!W$W3=)=|#q-* d}H$*d}$!V*d7ͽ6*d}%$S&*d}?$!V*d7ͽ6͐06!9 [%d] %d!9DMF=*d}q$J&! n}ʝ$ ʫ$ʫ$ ʖ% ʟ% ʭ% %% =06J&`iw#w͐|%͐)0d~#fo =?*d<%͐)0d~#fo =?*dn}(͐͐n&ͳXs! ^#Vr+s!9DM͐n}U͐n}.U! ^#Vr+s2! ^#Vr+s6.͐͐ X!9DM͐͐ ͐ ͐͐͐W!wa!za!za!9DM͐!za!9DM ͐| ! ͐!9DMͱ|x ;`is{= = G O e `in}2dx !wa;+++|b !wax ! V! Vx !9 ^S: pause ^G: abort this file ^C: exit immediately ^Z: abort all files !9DM͐> >!>!><! s#r%`i^#Vr+sñ$͐|7% =! s#r<͐=*de%! [$! [$! n&|g}o|ʂ%*dͰ:͐06!Ͱ:J&Ϳ<͑#J&ͨ<*d06J&<*d%͑#%ʹ2d*d}*d!W! ~#fo͐)~#fo!W͐PageStarting at page %d. PPausePausing for manual insertion of each page. PortUsing the '%s' port(s). PrintQQuietRRightRight margin width %d characters. TabTabsTab stops every %d characters. TTitleTitle string is '%s'. Unknown command line Z!& !9MemoPlan intermediate output for:!9DM*d}¡͐+|iE͐!WÂE͐͐!W!n|¡!V>2d!Printing '%s' on device '%s' -- OK? Printing %d copies of '%s' on device '%s' -- OK? -- skipping file. !9DM*d|7!H*d7"dE*d =?"d*d|Z ="dh*d =?"d*d|ʮ`iw#w͐|Ү͐)0d͐*d?s#r`i^#Vr+sz!=*d}!V*d*d7!="d!92͂*}*d}option: '%s' !9DM͐`i X!`iQX!`i^! s#rzҗ!`i X͐`iQX!`iQX!`i^! s#rzҗ͐!uí͐_͐`i_!9.COMA: .COMError in chaining: can't find %s.COM !9DM͐͐| <|"Ϳ2d! w#w͐͐0: *d}: >2d͐͐)! ~#fo! ^#Vr+s ͱ ! ^#Vr+s͐6һ ͐6͐)͐8!8 ~#fo͐)͜^!8 ~#fo͐6͐)w#w!8 ~#fo##!8 ~#fo~#fo!29MemoPlan Print Version 1.1, Copyright (c) 1982 Chang Laboraj!͐|(!͐|D*d}8!V!"d"dj! ͐|j! ͐|{!"d!Vj!1͐|¡!4͐|ʾ*d}±!;V{2d{2dj!\͐|G! ~#fo! ^#Vr+s)~#fo͠#|! ~#fo͐)~#fo!^u?*d}?! ~#fo͐)~#fo!wW>2dj͐ ͕͐͐͐! s#r͐DevUsing the '%s' device. LLeftLeft margin width %d characters. NHNoHeadingNot printing page headings. NMNoMarginsNo right and left tories, Inc. Usage: MEMOP file options ... Options: -dev -l -nh -nm -nopause -ns -o -page -pause -port -q -r -tab -t �Chain�ͮ!"�d! "d>�2d!�"d>2d>2d>�2d!��! ^" d|+ !��!+ ^" d|S �!�!* dP_�?|[ !; u!�!"d!͜^!�Ͳ!*"d}Œ *#d&�|Ҭ !�!�*#d&�*"d&�!m u!T�!0d!͜^!�Ͳ!!!�!d!͜^!" d!" d!"d"d"d*d}n >R2d*margins. �NP�NoPause�Not pausing for each page. �NS�NoSkip�Not skipping page perforations. �O�Can't create file '%s'. �Writing output to file '%s'. �!��9DM!͐|!� ~#fo!� ^#Vr+s)~#fo*W"d*d}*d!W!͐|!͐|#!"�d! V!L͐|m!� ~#fo!� ^#Vr+s)~#fo" d*d}j* d!QW!j͐|ʃ!p͐|©!r͐|ʱ>2d!x͐|!z͐|!� ~#fo!� ^#Vr+s)~#fo*W"d*d}d&�_�|g}o�|g}o,"d�config.dat�a:config.dat� �Can't open the system database file (CONFIG.DAT) �CONFIG.DAT is version %d.%d; this program requires %d.%d or later. �*d} *} !� !��#| ! V* d_Error writing output file (disk full). �!��9DM!r͐|b!� ~#fo!� ^#Vr+s)~#fo" d*d}_* d!vWj!͐|ˆ!͐|!� ~#fo!� ^#Vr+s)~#fo*W"d*d}*d!Wj!͐|!͐|*d}!V>�2d.w�w#w#w#w*>?=͉;w#͉2> w#=ͤͲd �2l&�0OxGͲg/ʃPxY͛.7:77!a{  ʥ ʥ0:?ŷO !y$� 7o&�))T])))!y �2k_ �:k��������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������*��� ��b͡z�dcnvzÕùEK]i0 2͵ ^#V#*~#fo^#�*~#fo^#V#*n^#�*n^#V# ~#fo^#&� ~#fo!�+!��#!�+!��#!�+!�+��������}|z{|}|z7||7zZZ)|/g}/o#��|͉k|/g}/o#ɯ2cZZk:c|/g}/o#|/g}/o#:c<2cqDM!��xxGyO҃)v|͔`i|)Öx��ڷz/W{/_ѯzW{_=yOxGæ2cZZ͉M|}ȯ|g}o)|/g}/o���������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������!9DM! V `i6#6�!0� w#w͐6|! V!4 V!_ V! V! u!� 6#6#z/W{/_!�9~#fo!� !� ! � ! � !� !� K!�9~#A!��9"q*�*q"e!c*"_!"a!Y"C>2Y>2\>2[2^>2m2n>2l>2p!�";!�"?!@�"=!�"A ���!�F#x�:~#!�e2d~# :" 2d +}|~#:G:dx."2d+w# +6�# !6�#@**|^+R2i2:*e!#"0�!#"2�!>ڋo&�͕=|  v~2ʷ͹�56�!��+W ?_�!~7z?ͤ:>�͛@w#2!7q:*7M͒:7o$+͛ͪ*$M ~28Om:8 I͇͢u$oqo͛rP! 6�!�"&*$"(R͎ҔM͢ҡÔ($ҵ! 6R͇vͶ2!*!Mm$"*"M :!w͢:! e2!:! : /HH/Q:! @!!6 R!!6 :!�KR$*&� :!w:<2dn!:s+q*$";!>6�:>/;oH*;#"(";:92=*=&� *(M !::=2>/H:=<2=*(#"(æÀ:>*(+"(R:>!6�$:2*�o/*!My:<2=O�!s Hq**DMͷ! 6: e!��"*""?k*&"?*?+M ~2A :h�Hҏ *&"?(?:A ½8*#" ҽ*?M ~2AO �*?"?ҕ!�"*"*"^: 2B! 6F:B2 o(>&H6͛9!C6�>!Ca R>:C<2C?! 6!�"͇͢Ґq"ڊ͛Íq!!6 !!6 !6*!Ma2D*!M͒2!:D/!+w!6�e2!͢!Eq!E:!:H:�H!Fq*FM8 *FM  � Oy2F :FY5>>�:!02HO> /!��";u*)))*) *H&� "PҘ! 6+s#ré! 6�"DM!��>))덑o|g =±^#V) ^#V|g}o _�{ozgi`N#Fogo&�og_�{_z#W H =��������������������������������������������������������������������������������������� LIB�����������������������X$$$$$$$LIB���:f *g&��!lq:l $ !h4:l 1 !h6�*lM :h�B     !h55!mq:m :hO>H2ny} !m6 !o6�:n!oښ *mM !o4‚ !pq:p ڪ >:p :p H:p H!qq*qM͛  ^W :q@2q*qMW   !sp+q*r �!up+q *tDM !wp+q*v �!zp+q*y�2x!|p+q*{�2x!~p+q*}�2x!p+q*�!p+q*�!p+q*�!p+q*�2x!p+q*�!6 �� � ���>>����! q* &��!p+q*6:0O  ú!p+q:/(*DMͩ:  : I N* *DM:�aO>�!Һ x!: ڦ>� ʡ* +" >�¡! 6�: <2 =O�! N͒:  O͒: ! 6�:h�!�o$��O* ͸ ! 6� !h6�!: 2 3* &� 6 : <2 =O�! N͒*dM � :sGsu �n>!6�:<2=O�!� N͒!">�!��"͎/Ҵ*+">>�!�": �*#"*""*!��".+",*$"**o".!�",!36:3{.�:7 e ��!p+q*DM  =? ) !p+q.*DMF -L *9"`!��"b!h�6�!j�6�!|�6�.!=\� -x !e:dʥ *eM \�R :xʥ @ *dM \�, :x \�͕ :x - V :e� _ :f� w : =e !e:d*eM =e : =e =͕ !]6�:x>- !�"!76�!6�!6�!66�*dM  *dM !6�:8!*`*;DM \�u 2x�ʻ>!xҨ- *`*;6:82�*`"`:<2w!��"`9`h*`*;~2*`#"`*22*,**"0M ~ H3*0"**+"*+">�23:2/k!36�,*+s#rx:3x*0"*: �“**"&*"+"(á*$#"&**#"(*"#""*$#"$*"+""*$+"$*#"!4qM*"*$: *(y"$DM}|C#~ *#"*&DMyxC 1*+":4?w+"$""�ͷR: �—*$"("҈!�"&Ô""&*""&$mڸ*o"(**$"($"O26͛*"M :6w͢:6 �:*eM !b+!s{!f!6�:!b*b*^DM =ͅ �N- �*b"b:<2)f!��"b!q9bڀ*b*^:w*b#"b!q:6ڶZͅ �ʱ- !66�*6&� :w:6<26!J6�*b}�:J<2Jm=? :x- : ;*dM .=\� -=ͨ ;: *eM =ͨ .M= -C!q:�Y*M !q:a/>z!/H!q*MaҎ:_:!q:ҥ*My:!p+q!'"!6�>�**ͪ{2**ͪ"*! �ͪ":�!! COPYRIGHT (C) 1979, DIGITAL RESEARCH DISK OR DIRECTORY FULL$FILE EXISTS, ERASE IT$NEW FILE$** FILE IS READ/ONLY **$"SYSTEM" FILE NOT ACCESSIBLE$BAK$$$BAK$$$-(Y/N)?$NO MEMORY$BREAK "$" AT $1mM�"m +!8s~<O�`i"9�*9m ��9m++s#r!9+s#r9�";9;"^*mM 6�*m+"o!o#s#r!6�!f6�!6:]� :m� H}- :\�2d�‘ 2dÝ:d=2d!\�6�:l�2e�±:d2eø:e=2eEU !M6 !�""*o"$!h6�1m!6#1m!6?1m!6>1m!f6�! 6�:!B)! >w!�"&*o"(R :!C:eR :!DKeX :!K\ͷX :!Lj^ :!Pš͎҇! 6F×͢җ:Ç :!T¨F :!U¾: 2 :!V͎"$DMͩ/ *oDMͩ : 2 :! (::�H%^bF : ͎H :!Ay! 6*""&*o"(R͎an͢na! 6�R :!F”͢ґ Ä :!J $:2$͢ :=2:<2!*&� ~2!ü*""I*M*o/!:" *M  *!M 1m! 6!6�! 6�: 2Ebͽ!e:d\:�:eH2� H҆ͽ:e2!:d2e:!2dû :!I¬!: :�H2 ҮX:h2iҐ:!�ʍ:!:!H:!H,!��"! 6�#~ F)ͷX:! X):i!h)9 e:!:h2jO>�F L>!":i!jHҼ*"+M ~ ʼͲ!f6!h6�!��"! 6�F!f6�:h2k!iҠ:i2k:j2h:k!hҶ9 æ:h2j!!6�:j2he:! 4"Ͳ*"M ~2!O :! *+""&! 6�R*I""ë :!M:�H| ! 6>F ͛e: <2 O�! Hqy d F : 2! 6�*#s#r :!N ͢ *�o/ Ҧ Ͷn! 6�!�"&R! 6o$ Î Ç :!S0 $͢- :2"+s#r!:* *&� ~2!:<2 :!W> v :!X³ Z͎\ Ee ð :7/҃ E!76e ͕ :xƒ - ͷ*&"K(Kڰ *KM N͔�*K"KҌ :!Z ͎  ͢ : :!�  'v���!gq!!6�e*!M͛ /$^L:!@OL:! 2͑e:�b:! L:h<2hb:! b:hO>!hw:! pX:! …!!6  LÊ!!6�ûô:!ʛ͑:! ҩ OҸû:!R†!6G>!!!6 :2.t -? >!!6�!6�s, !6:xB!6OU2!SB!G6�:҃!6:G҃*G&� ~2!:G<2G_ Qқ=e  b:!-®! 6�:!#¿͇;J:!:!!6Lv:!:Jv: *#"͎)6�> !).*)&�*)*)&�*) w:)<2)*)) >�w#6�*)) w#6�*)!) w#6�*)%) w#6�*)) N#F*)) q#p*)%) �*) ~e �*) �* ~o&��͞ *)%) q#p!)6�* >!)6!)6>!)=:)!)w=*)&�*)~2):)*)&�� *):)2):)�:*)!) *)) s, >�X\:)“>!d!�")>�!)d!��")!��")*++!)a*)) ^#V")]*)")*)) ^#V")]!)6> !)T*)&�*)~2)*)&�*)~2)O;*)) ^#V" h&�:0¬: 0$ʦ!��*R0 >P͘% >U̘%>: 2 3>E͘%��������������������99:Y=/9&ͩ c,Hͩ 9 EHͺ �����i`N#Fog_�og_�ogDM!��>))덑o|gҘ =†DM!��>))ҭ =¥~ ³^#V) ½^#V|g}o _�{ozgi`N#Fogo&�og_�{_z#W)*)) *)) N#Fq#p*)) *)s#r*)#")!)6 J:)!)J!)6 :)<2)�*)")҈q:tw͠ͱ!��"))ҍ*)) ^#V")]͠.*)DM\� -°!\�6�:\�ͣ:��ͱ*}�DM'ͫ*)%) N#F'ͫ*)!) N#F'k͐ͫ*)) N#FͫR͐/͐ �*) ~IO͐NW͐ͫ8AO͐:͐ �*) ~2)t(͐:)҃)͐*)#")Ã& \!��"))\Ұ*)")]͠*)M�! ^#V �*) >*) w �*) >*) w �*) >*) w �*) >*) w.*)DM\� -+!\�6�uͱ:)O�! DMͱ*)#")Ù*))))))"):m� w>�.Yn� -:YS:Z Hҧ!6> 2)�½>!)6> !)*)&�*)>2) :) .͐*)M͐:)<2)99:Y=/9&ͩ c,Hͩ 9 EHͺ �����i`N#Fog_�og_�ogDM!��>))덑o|gҘ =†DM!��>))ҭ =¥~ ³^#V) ½^#V|g}o _�{ozgi`N#Fogo&�og_�{_z#WL!*p+q*)O2'!,p+q*+O2'��O2'��O!.p+q*-L��R��R��L��R\�L��R"� O!/q*/&� L!1p+q*0#L~*##N!�ͽ�͞"T!Vq*VMͳ!Xp+q!W* >Wr#MͲ!_p+q!`6�>!`6*`&�*^*`&�Y />�!`4 >*]&�� ~ O!]49!a6�:a*]&�� ~2bO>z*bM >!b/~,H~:H~*H~.H~>H~<H~=H*]&�� 6!]4T!]4!cq*a&�Y :cw!a4:2͠!4 F :® )!6�>!ګ ͠:O�!9 DMi 8ͱ!6�> !ڤ Å :2k ä  ͐:!O�!Y DMi w !4C F :¿ >F : F :=229:Y= ;>9*&�Y DM =2 I>!6:=28 :2:2 :!�!2�9:Y T >:Y,e \>Ì !p+q*~:ʉ *N͐*#"o :͐!p+q!'"!6�>� **{2*́"PY! �">�!+~H !6:0O͐à k͐!gr+s+p+q!h6>�fr*d*f!is*d́"dPY! �"f>�!h#~Haͫo!h6�:i0O͐!mr+s+p+q*lTZs#r*l�ڶ*l�+s#r*jN#F+q#pÌ!nq!��"o"q}2uo&�"s�* s:n*sDM2u:uqos�*s"s*o͊O� �!v6�>!vQ*v&�w 6�`i+46)A*:'ʓ:'O�!) ~2vʍ:vO�!w 6,]!v6�>!v*v&�w ~һ*vM� �!v4˜8AO͐:͐ͱ*##N!�ͽ"�* N#F*͠"͠Q" 8AO͐jͱͷDM͏ m  Z"l"!6�>�ʥ *}҆ *M ͱ*}x O͐} W͐ͱ !+s#r!+s#r#4D ͠:\��ʹ :\�=Oͳͩ !6�!)6l :)� :)=2) :]� & !��"}2\�!h�6?!j�6?\�:'C:'ƀo&�")!)6�!��"):)/)HҘ]!)6> !)ڎ*)&�*)*)&�*) y!)6 Ä:) 2):)<2)M*)#")/:)ҩ*)+")`*")#"]�!�*)!�/H!��")!�"]*)) *)s#r!>�!H% - *DM ͱ�ͷDM  ͱ�* N#F 9ͱ �* ^#V))DM Tͱ�* ~<o&��͞DM oͱ*DM ͱ*N#F ͱ �* N#F ͱ͠!p+q͠*DM':͐ͫZ"!6�>� *} *M!+s#r#4 !s+p+q!6�!6�6:!ڄ !6!6�>!r *&�**&�Y i !6�!4+4A :} :!4- >�!6�99 2�¨ :�!4: :�2!6�+6�>! :O�!9 DMi ͱ:!O�!Y DMi :2$��$$I$�$H!!! BH" !I B  �$$��!B�D!��� $!BI D@"!$I$$H"���!��I$I$I$UUU$�$A$ �����������������������������������������������������������������������������������������������D$HD$$ H�� B!$D$"$B$DA!ABI$H B$I $HI$H$! $I ���������������������������������������$I$$A !A��@$I$"!$H$I�$I "! $A$  �HH��AA"I @��BB ��$A"3 Copyright (c) 1979, Digital Research????????????���CON:RDR:PUN:LST:DEV:VAL:USR:DSK:TTY:CRT:BAT:UC1:TTY:PTR:UR1:UR2:TTY:PTP:UP1:UP2:TTY:CRT:LPT:UL1:R/O�R/W�SYS�DIR�R/O R/W SYS DIR ** Aborted **�Active User :�Active Files:� � Drive Characteristics�65536: �128 Byte Record Capacity�Kilobyte Drive Capacity�32 Byte Directory Entries�Checked Directory Entries�Records/ Extent�Records/ Block�Sectors/ Track�Reserved Tracks� is �Temp R/O Disk: d:=R/O�Set Indicator: d:filename.typ $R/O $R/W $SYS $DIR�Disk Status : DSK: d:DSK:�User Status : USR:�Iobyte Assign:� =�Bad Delimiter�Invalid Assignment�Bad Delimiter�: �Bytes Remaining On �R/�, Space: �Invalid File Indicator�** Too Many Files **�File Not Found� Size � Recs Bytes Ext Acc�65536� set to �R/O Invalid Disk Assignment�Wrong CP/M Version (Requires 2.0)�!��9"2!T OË!]6:\��:]� Hr3 Ë:\��ʀË͇ /ҋͺ *2!"q*"&�L ͐ ͐ ͐!$p+q*#~�*#N͐*##"#÷!&p+q͠*%DMͱ�� O�� O!(q*(&�͓ !"� >- Ͷ Aګ ҫ _�!7^#V~  \p Z z ů2[�\�͓͢ ҫ ͐ =« f " � �͓ ҫ ͐ ʻf " �=ʻf "�=« ý> 2��͐ f "]=f =« *]}o�"_  *]"a. ~ #E }"]*a 6 *]}#|#*]E ͐ « f f f {zA|« W}d ͐ f f f DMʡڏ"=ʡͲ=ʡYPͲ1**!O~4#~#F#x~#s#r#w>͐ « f f  . ᯕo>�g.! _�^! ^#V~ x+ >= = !~  . ! �  #x f L L ͓ͅ ҆ *" �!�6�ï +"_*~ #E گ ʫ ^#V. ï ~ CZMEIABDHSP!��"M"+"!�91*~!O~6�=G#^#V#~x (#"!N#FW( *J>7Å*M|N+"M N:LHͅÅD Å >* *͓ b" �. *"] �!/~##ʁtZ�*F#n!Is!^#V&&##&))::^#V#*^#V>+)x-8_ 2|�2\�  !]�w# ʫ .&  0 6 #& .K !e� K w# ʫ : U 6 #K 6�AW w#] !e�~H#~E#~X*}|́ "!��́ ͐ !��ʬ =« f kʫ j �\�͢F �w# ͋ t ʫ : W& _& & O { `i"F & & w# & ͋ « t Y t Y GтWx ͢!o ~Z #N  *. *.  NEXT PC�͐ =« f  . ~ Ͷ ʻ .͓ =« f |« }w#Ä >2L͐ !�� =« f }ʫ +"MD Å D  �!  #�)*)þ))>+><7"9.Yͯ * M^2U :2:2ͳ:_³ͯ !6�!��� �@�!!BH� @�@A�BH B! "BHI$$BI$BI $ HI D$HD$$ H�� B!$D$"$B$DA!ABI$H B$I $HI$H$! $I ���������������������������������������$I$$A !A��@$I$"!$H$I�$I "! $A$  �HH��AA"I @��BB ��$A" ë «   Ͷ ͐ =« f xY |« }ҫ gA>S Ag}S S i |« }!w s#r:[�ʔ �_!�~ʦ ![�4ç \�͢¦ 2[� 7 >?  e͢!g"c> _͢a_!f~> 5*c~#"c � 0 7   > >  ͢| } @ >. *_}o| , 0 ë ^#V#!��Y ))))o P q s#r#!V4 !V6�# ,® >2V��ñ m ͅ m ͅ m ͅ « Vʫ ! X�N!~  >>!M7u�t66 6>!��!M7s6@�������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������6̀6S :\�=v5ABYŚ6CP͚6DIһ5DRIV85ERAS-5ER-5LOAĵ1RENAMG5REG5RESE45SAVi1TYP2*~#:>~Ä>:7> 7~#7 Bad sum�>28�!g6"9�!c6">!��>!��-�?6!�_S_z�6 !?7w#�8!�N#(6 [�_!�;�z8O!B N�#N� ��¾S�P�.�* �|} ��!��9"�:�q!"�<q<2�* �×͞@!�~ʃ5@* �͡.� ��;ͣW!E�# ¡ # ¬# ·@ʴʥzʖ=ʐ=|zJz?4)z zO=!9 Ÿ!6q!2qC� J� R� q!z z=naO $q$,�!;,�!Ù!;qz8O! !;,�z;qyO! ͣͣW_͕qyO! ͣ͒qyËCOPYRIGHT (C) 1980, DIGITAL RESEARCH DDT VERS 2.2$1�0 �!�~=W�!�xe ~#Xbxʇ {z~#o}o҃i.�*"#":2 22=_���2_!hp+q*g�!jp+q*i�!lp+q*k�!np+q*m0��2_!ppJ�Ã���O$*s�y͏ , $ � �͌ �9�!z6 # L�!zw͌�j�# X�:z 0 ͘=N#Fy}�80*z{¯�#z+++ ¥� z�#½�#� ·� 9�!`͠� y9�!rͷ�O!b q!vz͒q.�?�*�!��9"�8"�͉Z*�" �+*��'/7?v"*2:EI SPHLDI XCHGPCHLXTHLRET HLT CMC STC CMA DAA RAR RAL RRC RLC NOP CPI ORI XRI ANI SBI IN SUI OUT ACI ADI CALLJMP LDA STA LHLDSHLDMOV ADD ADC SUB SBB ANA XRA ORA CMP INR DCR MVI LXI STAXINX DAD LDAXDCX RST PSW POP PUSHNZZ NCC POPEP M B C D E H L M A B D H SP PSW ??= M�!Eâê ö  - Ð f  "J��*�"!"�!��"�2O!�" �"]""!�1!�++""M>28�!"9�:]� !��í 1 y��=!z{w# % w!P͠� y͓�}�*�w#"�͌ @.@<�!Eͷ�~P !ͷ�’P͌�Q!ͷ�ªP}�QxQ!ͷ��͓�G@�Q! ͷ� y͓�Gþ!ͷ� �͓�Q!ͷ��͓�Q͌�Q!.ͷ�6y#G͙�Qà!2ͷ�Q͌�͓�Q!>ͷ�q eg͙�Q:zJEËC–EQyQxQRQ*�* �{zҷ*�~#" �<AO�GƐ'@'O�xƐ'@'O�N�# >|ٴ8->�gogoO,-yRR||0-?|"-|E- ( ( # 7ɷ  ͘-͋-͋-ZٷRR͘-ͅ-ͅ-h-)j <AT]T]͗-c(yAOI!�8TER9W( K�8I!��D9�8 (ͥ-#x'ͮ-ͥ-,#b'ͮ-'!�9Ͷ c(�Ͷ x'x'Ͷ <#,=( I.8<<^-0͋-, >.-,˺ɷBB0 J?<jj0޷BB7|.0 J<Ü.BB 0 J <! #jj#jjҼ.BL_3~(w+++V+^B#3+++6�+p+q̈́3S3+˾+w6##ůw#͝343<3>!o3 >CP/M Error�O�$%3>(X3(>Disk full�!!�4#(\�>X3<3\�>X3>X3<\� ?(>Bad name�>o33!%�>Channel�{ȇ_�!=7^#Vz> e�!4�!|�q#OͲ4" $#Y4"#(t>Bad string�~#`?@#~:+x ~##\�~.(" ( (=("(?*(  #| N4y%5~#*(. e�(+�~ #BBC��Ͳ4~%508:8 A8G0))))_#Ͳ4!6%5( 8,~#(##B .)j8< BB J ~�A87?:?0>=<#+-+_͏/#,> ͏/#)>#{{yGͨ/~�~� #Ï/!:֍! xĴ,!ŇO� ~#fo>!M7!M7n�f^V!M7u�tsr>!M7> >|}7>{}>]l�bVI/VU/!M7s�rut!M7> ~oggoOm>�!M7Vu�x ( #I/!M7>ê �!M7Vu�t##x(I/!M7>ê . .VI/VI/V>y{z}|#%5.( ((~#(~#fo`_4: 64:\�={5_*4= -#>\�X3< /l� �43\�~ yX3>Bad command�>File exists�4ͼ4+ #ͼ4 ȷR>?4 !�3\�yX3S `_�!� �~ x> 67{6̀6S :\�=v5ABYŚ6CP͚6DIһ5DRIV85ERAS-5ER-5LOAĵ1RENAMG5REG5RESE45SAVi1TYP2*~#:>~Ä>:7> 7~#7 Bad sum�>28�!g6"9�!c6">!��>!��-�?6!�_S_z�6 !?7w#�8!�N#(6 [�_!�; V2:>}ê >ê V>}ê VI/V>{}ê !^1~^fdn`}lghyg͝5{54Ͳ3 >Directory full�̈́3 B(0>X3<>Close error�͝54ͨ3 >File not found�S3 ͝3 B0?{ 1 3ȯw+w!%�~#Ą3!�K:B S:772(_ͫ27n62 4Բ3ܨ3!L7~+(+>Too many open files�[:s#rx!�":!\�$�#q#G43xIG3x�+p#N˹4# w133N˹4#� FK313x3+~<3\�$�>#X33~++V+^+fo:U)C͈.`i`i,,O˼f,ͥ-@#ͮ-ͥ-,N#ͮ-'f,6,{f,6,˼#h'#ͥ-͟- .6m&sy}����ͮ-ͮ-c(ú#͟- .qxLpvȜ*{~����ͮ- ����If,]$F,{( ->怳˼ͥ- .r@.seoO.v7my*{O}V~����ͮ-T$?$Dƀ8--ƀ-O#,'r1f,>| 53"-y8 <-ͥ-͟- .Ht}~L~㩪*����ͮ-ͮ-c(ͥ--ր(0/<gͧ,˼]$c(0$ͮ-x'h$[^~c(/Ͷ ܨ/yOz,ͥ- (>8<+),n$ͮ-c(#@-- -Q@-- -@@-- -0@-- -(!@-- -@-- -!!ٯO~�#g�#o|�#gٯOgo#f)>,��8ͅ- ( (Ɛ'@'G͏/~(f!�:~!+(!�:�8,�|(˼>-(Gxy00%/8>1.c(G 1.'G> 1.-yO\-˹>� xN ݾ( >݆*ͅ- 8 , O|?g*< >>�y00(:?0u >0<=- >� >�8^F 2N(x(f,ͥ-͗-c(#h'"ͮ-, ͸! 'f,|˼T~-�8y-8T$-ͥ-͟- .57{k|Aa|{7}Z*L}\~����ͮ-ͮ-c(#x'h'F/ͺ-_K!��9%U/&�9goO͏/,>� #ͺ-V-}ٷ(=DC�8_!�� x(# ( #((78{ٸ8<om}�8>m/�8>67F/ͺ-V-}ٷ( =o�0DOͩ&͏/,#( +U/>F/ͺ-V-U/}ٻ0k_>̓&K}o�bX>VI/}_U/(=O>Cb.�~#> >+|g}o|g}o+|g}o+Pz݆_ 8x&+( ~ > 8PXxƁOz0 (;+J+>0B+6.#w#)+ M '6E#x=\+6-#D60( G>:8#604 60+4##F>y(6 # �G#~�;/~�+/8xG~�#G +d-xD#~�+/#v-8 �O 0#| ,,+-,,, |>+�ȷ!��R!��R/!��BDM>>#i!y�!��8:BRR0 ZZ?0=8)jj0շBRR<YO|!jj •,|)j §,,,, -|,ͧ,˼� � ɷyHG͌- |g}o+|g}o|g}o+|||,,|,DM!��DM!��>m.�,+',�,n-h-͸,zW|g h-n-͸, ,��|x,x+z'h-, n-(,͕,/!�B,,,˼ -͸,> |BK��BK��>m.z̈.8B?,,,y?Ü(||,,|,DM!��DM!��>͛.- z ,J, #jjJ(˼- |DM!��DM!��>͛.ܯ.!�R,,,y8--ƀO-˼,|,H ͅ-8,L!��9(4,T$#> ͗-. #z-*@:#+!xH�'0h 0h=U0\K 02x =y0(F x? 7y (O0CydO`y0!C$(x7y%0$Iy0> [@:7R}>}2G Iy0 x?>( > + |   }x Iy0p llu0_C((j`>G\x? y >==y0w `ͺ0 \ͺu !:Ooygxm_!�8~#x8x? yyC7y0h(D&>.>v7{ !xxX_>--~�7*( /((b/7p/;͏/^b/;p/F%F,F;;,;>FU/-/8#ͅ-ͅ-ͅ-ͅ-ٵo/0>f ,|gI͏/#&(-(+((("(cҁҠ/+:000t.(p% + (�G(Nn�fnf!��&�n�Lځ::o> ## 0!@:O�8~�#"(  0> ~�"#(+>-�+.�+E>�̍+|   Ȑͧ,˼ 1.c(8 D1.'>&1.'&F^�V^V�80 }ٷO>�~# > f| ,˼m|/g}/]>p(>Ww�#~�)!��V}x??2/2&x07>x ?O!_�7(?~(�_( ~#(#~## ~�_(8 xF#8D#+-NO�RLCEX�AF�AFRRCRLRRDA'CP/SC7CC?HALvEXEX�DE�HDENEDIM�FRETERETMIM�VIM�^RRgRLoLDɠCPɡINɢOUTɣLDĨCPĩINĪOUTīLDIҰCPIұINIҲOTIҳLDDҸCPDҹINDҺOTDһBI@REӀSERL�RRRRSL SR(SR8POPUSEX�(SSUANĠXOҨOҰCиADĀADÈSBØINDEI@OUAJ DJNJCALo|/g}/oٯ0u0p92ʦ)-9ͫ2oY<&͏/( mDMhCL&vʦ)*�81v+*:(*:#*:~�#P*:*: *:*:&�ٯOgo7v> !�872o92 92/O!I!!c(!'f,.ef-|¦)-,v!�8͏/;/b ->�óv> �8!�8� ͺ-!�9F9!:͏/((  jj](?Om!:|7 -, S"ͧ,˼{=ٳ�,,c(,,f >D+,x,Of,|> A,yր/ƀO!��DM!��DM>.x./RSREL@]�]�OP�]���(H(I؆(IBD H I،IASNNPP( �I�GR�OA�WA�_(BC�(DE�A�(B A�(D�)!!c!!Y!^! $X0F!$-%"!:#!!w!|!"#!-0!+!%"S!h$$ !!!"0 !!E"!H#"#h!)!!/&L&<&&R&&*&!&K'&' '))p)O))(n'_)X'('&H'&' '{))k)J))c(x'Z)b')'v))f)E))U)[(b/[p/lb/lp/2/G#͏/2/ #ʁGx: d/p/=ͺ-{K!��9C�8͚/&�9O~�-(+b/p/#ͺ-{K!�8Ty(Eou�#t�%8F~�,(U/#p�8+8($($r0 ":z(+6�͏/,ª #͏/> !> (PG~)x(*:!��LV#*:# kC͏/,ª #F}͎2|͎2}͎2|͎2y͎2K!�8 ( ~#͎2> ͎2"�!�:(::( (0Dͬ:�:O�L(8ˀ#~(;(,(e(+F)J*)yԬͺ@S ê #!��":͏/#ʪ +":#(V~�#(>' Cx )(&G (L(#, mx(%L(1#~�#( >(mL͑ ʧ >)mIͱ!Rʪ >&Iͪ !B>+ V- Ū #!��( (+V+":ê V}7~�,(; |7#L ê 91ê 9I/V}͎2ê V��9͏/, #͏/zs#rx2�9͐ê m$!!�:K1N~FN V^f n0!�9OVI/Viê %  XOG(qu�tut,(u�!�80? {o|ٻ0e�O K:B7(`i�K S:*:$rدKѯG(> >#͏/% 88 OGI _ͺ-͏/, ,(>U/) x<=-#͏/zѷGê >" ~�>$ #OG!��L!�~� #OIͪ !OB> sL% R P!�9Ͷ ~ z> ͨ/!�9Ͷ ,>ͨ/$ !�9͏/,ª #ê !�9!OB(>!I+ (9>8*:>8!#͏/ 8 c s#r> G > ^#V!�9͏/( ͏/(U/es#rê !B(!B( !,B> +% -Y͏/,ª #͏/!,B(!Bʪ > x!��9YC͏/,ª #͏/zͫ2oͫ2gͫ2o& KI!��EB9G( �8E,I͏/,(~� ,);\͏/: ͏/#=>( (8'S V~�,(U/}!:S #VU/ 0m}G> Z !�8~#Z ͏/�8~ #͏/"#= +�8~�, #�N ( ### +7bk))!��>)#0 = ͏/#>-#m#:(] +*@:!:v(*<:7+#~�R ::R*@:"@:w(*<:"<:g(|}(::>Ԇ~�# >͆B s - S K> Ɛ'@'s 2gͫ2O!�8ͫ2 (w, #(� #!�96 Lʪ #,(M;(I" = ͺe +z~# ̚y!ˁA >?Z > Z !�97G2:~ ##*:~# zO":͏/,ª #͏/>#>*V-(~�ª #͏/ª î~� #ʧ /2:ê �ͪ S Ø ê Ͳ*:*:L( m͑ >) >":ê 9X{V2ê XV.�":ê XV/ê XVͲ":":ê XV[:R[:":rª ê V}2:ssing No such Bad  rangevariableOut ofNo  spaceroom����Mistake�,�Type mismatch���"���Not ��Array�Subscript�Syntax error�Escape�Division by zero�String too long�Too big�-ve root�Log�Accuracy lost�Exp���)�HEX�/�call�Arguments��Can't match � ����� syntax��line� ���#�͎ ~(Q#^#Vz(++7B0@N#V}2:ØO( x  !:��>~(#^#Vz(#7Bҗ":=n6Ͳͷ *:[:~(/#N#Fx(q#p# -q#p#++GN $r8�6#6[:*:Ny(##^#;?=ol:--7^#Vz(Ebk##~##�(( +~�((# 8 ((~ 0~$%<ɯ[:r+sw#w## 8w# 0(( ~((#6�#Q >(=6�#= ":I͏/-+|-ͧ | . L#! �ħ xSilly�ͧ L#ħ ͑ ~�$%(0:?A[?_{?ɯ�#{0~� 0˩˙ (,(G8˙" ?a(ˡͧ |ļ  ( *(80@( ( ( 8& ! � ! �  :6#zG{Tw#{?@w#z?@w#*:~#s  ];jw|V#":#s#r# �> ͱ)DM*:^#V#B^#V#8( Failed at �*: S ͼ ͷ ":y2:) program �ͪ*:###�> }w̓Ø_> iͲ͎_> [:*:RDM!�8r1×{:!8( G# ":{:2:ͪ ":( *:|ª !��":":1S �1S Ø!W~�F#(#~(#~ #~�.(( 8~ +x�N *:RDMS:[:!�9RDM!�8ͻ1Ԫ>�͎+6+6$*:�> N ( +#(i###":*:6�ͣ*:":":!l:p6�# ~6 6 > �FZ x�NĬy�VĬ~6 0FYm f=1C##0 d0 .1*CQ10OR0}#`nh M1L( _> {:i{:!:_(wwͲ!��":*:>":*: ":n6͏/#:( (8oO�! ~#fo͏/ͪ |ʘ�1×~�� (*:|V^R>[Z >]Z > Z _> !�844> Gç (d(w(L(+ʪ 86X_ê ":n6K8 (!:~0w%  >!>FC!,B(!B> ":�8Xx!��9Y% 8{Xc ~�(z r�B#V| W##6 �~# (F" * ͱ) C ,(s ~( D (  Q > Z > 7 (::<2:*:Z !W~#Z *:<ЯGN#~#foR Û �[:*:R0N ( R8B#^#V":!��*:| at line �� 'R<0=(Z x()T]))7c ~�( h>~�$(b!(b?(b ~�( A~(#��#I/VN#F#%B>0= U/W~�?(!(z>>!���z,#m~ ~�!:(C!:(<7@&�0o~% ~(()�:##*×Ä Îòz 4ë2Î221!�:6 ,6 ,w, =2:!v":͛6S:":ͪs Acorn BBC BASIC Version 2.20 (C) Copyright R.T.Russell 1983 �7{:7!:~0w!��":":*:":|( K:� -":> Z !�872:!�8ͧ ͏/|(":�9 GK*:|!�9ʪ ͎͑ NyʘO*: $r":#RDM(#q#s#r#�9 ̓ØANDABSACSADVALASCASNATNAUTOBGET�BPUT�COLOURCOLORCALLCHAINCHR$CLEAR�CLOSE�CLG�CLS�COSCOUNT�DATADEGDEFDELETEDIVDIMDRAWENDPROC�END�ENVELOPEELSEEVALERL�ERROREOF�EORERR�EXPEXT�FORFALSE�FNGOTOGET$GETGOSUBGCOLHIMEM�INPUTIFINKEY$INKEYINTINSTR(LISTLINELOADLOMEM�LOCALLEFT$(LENLETLOGLNMID$(MODEMODMOVENEXTNEW�NOTOLD�ONOFFOROPENINOPENOUTOPENUPOSCLIPRINTPAGE�PTR�PI�PLOTPOINT(PROCPOS�PUTRETURN�REPEATREPORT�READREMRUN�RADRESTORERIGHT$(RND�RENUMBERSTEPSAVESGNSINSQRSPCSTR$STRING$(SOUNDSTOP�TANTHENTOTAB(TRACETIME�TRUE�UNTILUSRVDUVALVPOS�WIDTHHIMEMLOMEMPAGEPTRTIMEMis1`!�~�(6#~ (A8,C0(2>2͑ CP/M Disc Verifier 1.00�>B2͑ CP/M Disc Verifier 1.00�͑ To verify a disc place the disc in drive �:̈́͑ and then press the SPACE BAR To return to CP/M press RETURN�n i >�2͑ Verifying track �:A22 2! >�>�2y2ͻ !>ͧ: (Verify error� yP%2: ͑ Verifying complete To return to CP/M press RETURN�:(W͑ To verify another disc select drive to verify Type A or B�n iA(B 2>B2͑ To verify another disc place the disc in drive �:̈́͑ and then press the SPACE BAR�n i {�(��> _�~#Ą ̂ �(��>̈́: !�� 8 ,$.�  G>0̈́>0̈́>0̈́|&}.�����_��*�����i��� .DISC T &."u:.>&2<Ç.&.:<.>&y72<*<�~T.;>0̈́>0̈́>0̈́|&}.return to CP/M press RETURN�:(W͑ To verify another disc select drive to verify Type A or B�n iA(B 2>B2͑!�~�(&<�_6 oO #~N(TF(\6 �T � Command line not recognised$ Command line not present$#~ (o >#~F o O #~N(TF(\6 �T � Command line not recognised$ Command line not present$#~ (o >BPART2 DFS���:���������������MESSAGE DFS���;���������������WELCOME BBC���<����������������INDEX BC���=>���������������KEYBD BC���H?@ABC������������SKETCH BC���D����������������CALC BC���)EFG��������������ALPHA BC���"HIJ������������� �>>>:>>>> >>>> >a`�  {d�  >S>K2"y2!{ͤ( Disc fault�Disc write protected���������*�� �����*; ʘ1��"<G-1> Q1T :T ͑-1w:y7 1ɯͤt enough memory�2�(���(��> _�~#> <  >>͕> >>>͕> >: !�� 8 ,$.�  G>0>>0>>0>|&}.>>Kfrom �:>>>Kto R!B >:LDisc fault��X��c�*������_��*�����i����K��"��8"<DISC 7> y77:<H/*<4/*<~Acorn CPCPMDISC_]/~ʏ/=G+~ʏ/!1s/+<=ʌ/+Ä/~>.!1!1?*<O� DͶEͶT /;<Ow+ / ;Ò�+ '0"0<0>0%0,0 0 0;0!( 1w+ /"00b&�:*; 0: :w0W0PX D0|B0>:/M � �����00<0>0%0,0 0 0;0!( 1w+ /"00b&�:*; 0: :w0W0PX D0|B0>:sO1p!�~�(7#~ (A8-C0)2Q>2N͚ CP/M Disc Formatter 1.30�>B2Q͚ CP/M Disc Formatter 1.30�͚ To format a disc place the disc in drive �:Qy͚ and then press the SPACE BAR To return to CP/M press RETURN�͆ ^ ͚ Are you sure you want to format the disc in drive �:Qy͚ ? Type Y or N�>!�͆N^Y >�2M͚ Formatting track �:QA2Q292!2.2B!9>�>�2Ry2(25 !>w+w+>�w+yw+Ͱ !!>:-(.(Formatting error�Disc write protected�c!.>:8(Verify error� yPڔ2M:9x>�!w#!w#:Q2B:B2B͚ Formatting complete To return to CP/M press RETURN�:N(W͚ To format another disc select drive to format Type A or B�͆ ^A(B 2Q>B2Q͚ To format another disc place the disc in drive �:Qy͚ and then press the SPACE BAR�͆ ^ {O�(��> _��(��~#y w >y:M !�� 8 ,$.�  G>0y>0y>0y|&}.:R=> 274 --> FILE: BPART2 .BBC CRC = 58 47 3E 40 --> FILE: KEYBD .BBC CRC = D4 84 --> FILE: SKETCH .BBC CRC = 93 F3 --> FILE: CALC .BBC CRC = 1E 23 --> FILE: ALPHA .BBC CRC = 0B 64 --> FILE: BATBALL .BBC CRC = EC 77 --> FILE: MUSIC .BBC CRC = 3A F9 --> FILE: CLOCK .BBC CRC = 79 5C --> FILE: PATTERN .BBC CRC = A0 57 --> FILE: KINGDOM .BBC CRC = 79 B6 --> FILE: BIORTHM .BBC CRC = BA :2K Copying complete To return to CP/M press RETURN To copy another disc place the disc in drive �:>K and a formatted disc in drive �:>K and then press the SPACE BAR�( ( {K CP/M Disc Copier 1.30�>�2:A2K ��u>!�(  K Copying track FROM �:>:G!�:2>KPlace disc to copy TO in drive �>>>>:>K and then press the SPACE BAR�>!�( K Copying track TO �:>!�:2OyP82:2))��>�2:A2K Copying complete To return to CP/M press RETURN To copy another disc �u(  KPlace disc to copy FROM in drive �:>K and then press the SPACE BAR�#~ (ɷ>[�!R88> !kR8/>!9R8&>!R8>!R8�Not enough memory�2�(���(��> _�~#> <  >>͕> >>>͕> >: !�� 8 ,$.�  G>0>>0>>0>|&}.>>Kfrom �:>>>Kto s1!�~�()A8"C022GA8C0 22 >A22>B22K CP/M Disc Copier 1.30 To copy a disc place the disc in drive �:>K and a formatted disc in drive �:>K and then press the SPACE BAR To return to CP/M press RETURN�(  K Are you sure you want to overwrite the disc in drive �:>K ? Type Y or N�>!�(NY K Copying track from �:>>�2:A2:A2�:G!�:2>!�:2O> >>yPڮ2:2:2ì:2 match - �: ̓ : J M @ Quantity of lines failed parse test - �: ̓ : ~ M @ Quantity of file(s) not found - �: ̓ * �d͔  ͔ 0T  Җ Wyʩ 0T 0zti�������il������������������������������������������������������������������������h�2|�2   ~$#~# x  �: F} *}= ">͇1 ]�<u  ^ �u CANNOT CLOSE CRCFILE$]�͐ ++ABORTED++$ �: ~ 2 M @ Quantity of file CRC that matched - �: ̓ :  M @ Quantity of file CRC that did not --> FILE: BBCBASIC.COM CRC = F5 EC --> FILE: UNLIST .COM CRC = 91 18 --> FILE: CONVERT .COM CRC = 27 40 --> FILE: RUN .COM CRC = 00 00 --> FILE: MERGE .BBC CRC = 07 3F --> FILE: SORT .BBC CRC = 21 EB --> FILE: READDFS .BBC CRC = 7F B9 --> FILE: 6502-Z80.BBC CRC = BC 61 --> FILE: FORMAT .BBC CRC = C1 5A --> FILE: VERIFY .BBC CRC = F1 13 --> FILE: WELCOME .BBC CRC = 90 39 --> FILE: PHOTO .BBC CRC = 15 03 --> FILE: POEM .BBC CRC = 43 83 --> FILE: MESSAGE .BBC CRC = A5 B1 --> FILE: PHONE .BBC CRC = F9 B5 --> FILE: CRC .COM CRC = B2 07 --> FILE: INDEX .BBC CRC = 3E 40 --> FILE: KEYBD .BBC CRC = D4 84 --> FILE: SKETCH .BBC CRC = 93 F3 --> FILE: CALC .BBC CRC = 1E 23 --> FILE: ALPHA .BBC CRC = 0B 64 --> FILE: BATBALL .BBC CRC = EC 77 --> FILE: MUSIC .BBC CRC = 3A F9 --> FILE: CLOCK .BBC CRC = 79 5C --> FILE: PATTERN .BBC CRC = A0 57 --> FILE: KINGDOM .BBC CRC = 79 B6 --> FILE: BIORTHM .BBC CRC = BA #CRC.COM 5.0 6/18/82�CRCKFILE???�!��9" 1 M @ CRC Ver 5.0 CTL-S pauses, CTL-C aborts �:]� O@ ++Searching for CRCKLIST file++�@ Now searching for "CRCKFILE" file++� ! � 1 .) F! � �͡�]�͸�! ͔0�CRCKLIST???��CRCKFILE???�!��9" � M à*,*.}|ډ!��".*,{z{**� �u�*.".G*.",��!��".***,}>*.#".ɯ22)!� ",". �< � NO FILECRC FILE$!  � >.� @ Checking wi*#"ɯ2i2}!� "!��"]�]�<S ;� NO DIR SPACE: CRCFILE$1 >�2 s : ~# ++FILE NOT FOUND++$: F*}’">͇†]�< � CANNOT CLOSE CRCFILE$�CRCKLISTCRC�SK FULL: CRCFILE$�� � w# �!]͐ DONE$!e� S!]�Q� !e�Z� @ --> FILE: XXXXXXXX.XXX CRC = �oS) \��<‘@ ++OPEN FAILED++� !��" !�" * |� �ʹ�) \��!�~2 #" Ý: ) > T : ) @ ++FILE READ Eth file - �! ~T #M M 2 2 2 2 ! >�2 3o: : @ ***No CRC Files found***$�> ʉ ʉw#: <2 P6: .6�@ Can not parse string �! ~ʽT #ñM ! > 6 #6^#6�! ~T #! 4M #x]�� #�e� w~ T #>2 @ - �s M@ File not found �! 4 >2 o: G: „: G: „@ *Match* �2 ! 4@ <-- is, was --> �: ) > T : ) M 2 ! 4<2 ~# @ Not a space between CRC values�<2 G-CATALOG???RROR++ �<* |): o% |g}o" 2  ; 0T ~T #~A > T > _h �: F{͇��2h�2|�: ʲ !\�  � :\�2 ! \� � \�� ! \� � \��! \� � \��<7=Ɓo&�  � ]� � 2h�2|�2   ~$#~# x  �: F} *}= ">͇1 ]�<u  ^ �u CANNOT CLOSE CRCFILE$]�͐ ++ABORTED++$ �: ~ 2 M @ Quantity of file CRC that matched - �: ̓ :  M @ Quantity of file CRC that did not�@ ++ Now searching for "-CATALOG" file++� ! � ) .) �! ”>.”#””͡”››tK››͸›* =: =͔="  ʳ ª~#.  ¿~  #~  .+~#0:0~#!A.O.Gy~#0M0 K MMɷ:m�2 FSÄ�CRCKLIST$$$�››tK›,� › **}|!��"*{z*~�]��*"Ü � DISK FULL: CRCFILE$��!��"*~͉͐ͤ>`is͐ ͐͐ )͐ͤ>`in&�#&�=?!�9!9DM`iw#w͐~#fon&�>:}ʓ?͐� �?͐^#Vr+snѯg`is#rT?͐�Ú?!�9 7*P͏B:q2\��5?> 2?!�*P?7,?> 2h*P/:q2�> >@:h):R*@=*@=> >@:qw#w#w:ho&�552?7:P,>]@2?!�^#V*R:Tʆ@=w@Æ@*PͶB*R!�s#r7:P)V>5Az>5Az2:P,"j!��"l*T|*l@5*R�*j!�ѷ@2?@@!@*l@*T+"T*R�"R*l#"l*j!� N#Fp+qx½@##6>2?@2?7*T|DM*R*PjA><^A~# x^A ><zA~+ xzA|}#7*R*P:TOz§Aq#ßA7:P)"XV>ZBz> ZBz2:P,"j!��"l*T|B*j!�^#V*X#^#V�Br+s*l5*R��"R*j"�*l0B2?B#"l*T+"T*j!� N#Fp+qxA##6>2?�B2?  tB �> _� �ƒB�  !\�/:q2�5!��> 2?+ ,B>2?)~2#"j!!�~#fo#�^#Vp+q*j~#foCs#r5 ����Û�E�(���Ɩ�(���(��ɻ�(��Û�(�Ɯ��(��Û�F�ñzA|}#7*R*P:TOz§Aq#ßA7:P)"XV>ZBz> ZBz2:P,"j!��"l*T|B*j!�^#V*X#^#V�Br+s*l5*R��"R*j"�*l0B2?B#"l*T+"T*j!� N#Fp+qxA##6>2?�B2?  tB �> _� �ƒB�  !\�/:q2�5!��> 2?+ ,B>2?)~2#"j!!�~#fo#�^#Vp+q*j~#foCs#+s͐|-5͐)c^#Vr+s!� ^#Vr+s5!��9DM*c͐+))͐!_))͐!_))####;A!� ^#Vr+s!|Җ5͐)c^#Vr+sn5!��9DM͐ �~#fo|5͐ �~#fo�͐�~#fos#r5͐))_͐�~#fos#r͐�~#fo|(6͐�~#fo �͐ �~#fos#rF6͐))_##͐ �~#fos#r!9DM!� w#w͐ ))_~#fo`is#r͐�|6͐ '�kOL$�n!� s#6�͐͐�!T! �͉##͐ '�kOL%�ng!Pm7͐6!� ^#Vr+s͐��~#fo`is#rl6͐n}0 ;!� 4͐n&�>:}*;!� F?-;!��!� s#r!� ^#Vr+sn`is{.u;!� F?!� s#r!� 4!� ^#Vr+sn`is`in&� :}Dʡ;U;X;O;C5<Sf<=͐~#fo|;!� ^#Vr+s6-͐͐~#fos#r!� ^#Vr+s!� 6 ;!� 6;!� 6!� ~#fo!� n&�!� ^#Vr+s~#fo!� ͤ>ѯgs#r<!� ^#Vr+s!� ^#Vr+s~#fos!� ^#Vr+s<!� n}y<!� 6#6�!� ^#Vr+s~#fo!� s#r͐n}<͐|<!� ^#Vr+s!� ^#Vr+sns!� ^#Vr+s!� ^#Vr+sÔ<͐6�!� !� s#r!� n}L=!� ^#7!�9!��9DM͐͐n&�9s{:7!� ^#Vr+s7!��9DM͐͐n&� :s{k7!� ^#Vr+sD77*T}DM*R]*P><7{ʍ7#*P|/g}/o{ʦ7# xš7#Í77*T}7DM*R]*P +><7{#7+*P|/g}/o#!{7+ x77!9DM`iw#w!� ~#fo͐�n!� ~#fo͐�n}J8!� ~#fo`i^#Vr+sn}G8!��v87!� ~#fo͐�n!� ~#fo͐�nѯgWv8!�9!9DM`iw#w!� 6#6�͐ n!� s{ ʲ8!� n} 8! � ^#Vr+sÖ8!� n}-8!� 6#6! � ^#Vr+s! � ^#Vr+sn!� s�>:| 9Vr+s!|L=͐͐!� n})=!0�,=! �!:=!�9~#fo#|I=!=><͐n}ʐ=͐͐!� ^#Vr+sn&�!~=!�9~#fo#|=!=>L=!� n}=!� ^#Vr+s!|=͐͐! �!=!�9~#fo#|=!=>Ú= >͐͐`in&�!=!�9~#fo#| >!=>:>͐͐`in&�!+>!�9~#fo#|:>!=>Ü:!�9!��9DM!� n&�|ͯq>!� n&�|ͩ!��9DM!� n&�|ͯڠ>!� n&�|ͩ!9DM͐͐ >͐^#Vr+s͐>͐0�>͐7�s!�&�=?͐ ͐͐ � �?!� nѯg`is#r8͐͐�?09!�9!��9DM!`B!� m:!9DM͐`is#r!� ^#Vr+s!� ^#Vr+sns{ʉ9c9͐�Ð9!�9!9DM`iw#w!� ^#Vr+sn}9`i^#Vr+sç9͐�9!�9!��9DM!� n&�F>|9!� n&� �:!� n&�&�!��9DM!� n&�u>|1:!� n&�8:!� n&�&�!��9DM!� n&�|ͯi:!� n&�|ͩ!Y9DM!� ^#Vr+s~#fo!� s#r͐!� s#r!� ^#Vr+sn`is{=>`in}%>!� !� s#r!� 6#6�!� �s!� s!� s͐n}-:!� ^#Vr+s!� 4͐ is invalid. �Header page count (%d) does not agree with actual (%d). �Actual page count to small, file not recoverable. �Actual page count invalid, rounding file size down. �Invalid page size (%d) on page %d. �Invalid gap size (%d) on page %d. �Invalid next page pointer (%d) on page %d. �Invalid previous page pointer (%d) on page %d. �Invalid buffer number (%d) on page %d. �Maximum of %d out of %d pages have been used at one time. �Invalid 'len_indx' pointer, buffer %d. �Invalid page count (%d) in buffer %page %d. �!9DM`iw#w͐)c~#fo))_~#fo!� s#r͐|ʅ1͐!T! �͉##͐ n&�ʅ1`i^#Vr+s͐�~#fo!� s#r71͐| 2͐͐ n&�͐ !299͐ ͐)c~#fo))_~#fo!T! �͉##s͐ #�s`is#6�͐)c~#fo))_~#fo!� s#rK2͐ #n͐��K2͐͐ #n&�͐ !399͐ #͐�s͐ ##~#fo|ڣ2͐ ##~#fo͐##~#foڣ2͐ ##~#fo͐##~#fo2͐�~#fo|2͐͐ ##~#fo͐ !-399͐ ##w#w!�9Invalid %s page pointer (%d) in buffer %d.d. �Duplicate page (%d) in header. �Creating name ('%c') for buffer %d. �Buffer %d has no pages, deleting the buffer. �Buffer %d contains recoverable data. �Buffer %d is empty but page count is %d. �Buffer %d has an invalid name, set to '%s'. �Buffer %d has an invalid file name, set to '%s'. �Unknown mode (%d) on buffer %d. �Buffer %d looks severly damaged. �point�mark�Invalid current buffer (%d). �Internal error: no current buffer. �Invalid default search string, clearing it. �Invalid default buffer name, �Invalid %s page number (%d) in buffer %d. �Invalid %s offset (%d) in buffer %d. �!9DM͐�n&�#)c~#fo`is#r*c͐�))͐�!_))####͐�!_));A͐�n&�#!� s#r͐|3͐)c^#Vr+s!� ^#Vr+s3͐�))_͐s#r͐�~#fo|'4͐�~#fo!� s#r3͐�))_##͐s#r!�9!��9DM͐))_##~#fo�͐))_~#fos#r͐))_~#fo �͐))_##~#fos#r͐))_##͐))_##~#fos#r*c͐+))͐!_))͐!_))####;A!� ^#Vrresetting it. �main�Invalid default indent column (%d), resetting it. �Invalid default fill column (%d), resetting it. �Invalid current tab width (%d), resetting it. �KILLS buffer does not exist, creating it. �No pages available for KILLS buffer, swap file not fully recoverable. �KILLS�KILLS�KILLS�KILLS buffer has an invalid name '%s', resetting it. �KILLS�Buffer %2d, %8s has %6u characters in %3d pages. �Updating invalid pages in the swap file. � Swap file read error on page %d. � Swap file write error on !*_ �~#fo|)!*_*L)c~#fo͘5*_�~#fo"_ !i.*L'�kOL�*L 1!o.*L'�kOL �*L 1*L#"Lå */L&�'�kOLn}!*/L&�!t.99>�2/L*/L&�|!*/L&�'�kOLn}!!/L4í!*/L&�|!!.99>�2/LQ!� s#r͙͐9|"!.99͐6�!� ~#fo(�s#r͙͐9|V"!.99!/͐Q9!� ~#fo �s#r!�!mI͐;A*mI|ڏ"*mI|ڵ"*mI!/99!��"mI!�͐!mI;A!� ~#fo##s#r!�!mI͐;A*mI|"*mI_|#*mI!G/99!A�"mI!��"kI*kI*L'�kOL$�nѯg`'`i~#fo*L'�kOL%�n*kI�))N~#fos#r*kI#"kI'*L'�kOL$�n&�͐�*L'�kOL*L!g099*L#"L&!"mI!��"kI*kI*.Lѯg҂)*kI �kT�n}x)*mI|'!��"mI!099!��*kI##)))͐G@|*(!�!c͐͒@�?�|9(*kI##!099*kI �kT##~#fo"c*kI �kT�~#fo"c*kI �kT�n}2c>�2c*kI �kT�~#fo|(*kI �kT�~#fo!T! �͉##}2c(>�2c*kI �kT �~#fo|)*kI �kT �~#fo!�͐!mI;A!� ~#fo##s#r!�!mI͐;A*mI|M#*mI|s#*mI!x/99!�"mI!�͐!mI;A!��"kI*kI�!�ҡ#*kI0L6�*kI#"kIy#!� w#w!��"L*L|$*L'�kOL%�͐s*L)c~#fo"kI*kI*L#)c~#foҦ$*kI))_~#fo"_*_|ʜ$*_!T! �͉"mI*mI�0Ln*mI�|g}o��|g}os͐P*mI##s͐))N*_##~#fos#r!� ^#Vr+s*_�~#fo"_ $*kI#"kI#*L'�kOL$�͐*L'�kOL%�nѯgs*L#"Lï#*M}¨&!/99!��"mI*mI*.LT! �͉##}2c)>�2c!��*kI##)))͐G@|[)!�!c͐ͬA�?�|j)*kI##!099!p)s). �99*kI#"kIî'*mI|—)!)Ò) �99>2-L!��!��͐G@|)! �!-L͐ͬA�?�! �?*!))Swap file update error. �99͐͌A!*/*Swap file recovery complete. �99!�9memo.swp�a:memo.swp�Can't open swap file. �Swap file header read error, file unrecoverable. �Swap file marked valid, verifying. �Swap file marked invalid, recovering. �. � �Header page count (%d)ѯgB%*mI�0Ln*mI�|g}o��|g}o|B%*mI#"mI$*mI*.Lѯg]%!/99å&M"#N!0*#NQ9!0*#N �Q9*#N�*#N �*mI##ss*#N�#*#N �#�ss*#N�##*#N �##��s#rs#r!��"kI*kI|%*#N�*kI6�*kI#"kI%*#N$�6*#N&�6�*#N%�n&�))Nw#w*#N%�n&�P*mI##s*mI �kT*mI �kT#�ss*mI �kT##w#w*mI �kT�w#w*mI �kT�6 *mI �kT�6&!%0!M7|&!M!+099!a0!MQ9!��"L*L|Ң'*L'�kOLn}ʘ'`iw#w!kT#n*_!T! �͉##�r*_n&�++ �kT�n*_�n}r*_�*_ng!T! �ks#r*_#n}*_#n&�++ �kTn*_!T! �͉##�*_#n&�++ �kT�n*_�n}*_ �*_#ng!T! �ks#r*kI#"kI*.L&�*.L͐�!z,99!��"kI*kI|N*kI)cw#w*kI#"kI,!��"kI*kI*.LѯgҶ*kI �kT�n}ʬ*kI �kT �~#fo|¬*kI!T! �kS3*kI#"kIT!��"L*L|ҝ*L)c~#fo"kI*kI*L#)c~#foғ*kI))_##~#fon*La�s*L'�kOL#6�*L'�kOL*L!-99*L'�kOL �͙9|ڧ*L'�kOL �*LA�s*L'�kOL �#6�*L'�kOL �*L!-99*L'�kOL �<7!��"kI*kI|n*L'�kOL�!� s#r͐*kIn&�"mI*mI|d*mI|d*mI|d*mI|d*mI|d*mIY|d*L͐*kIn&�!&.99͐*kI6�*kI#"kI*L#"L!��"L*L|ҟ *L'�kOLn}ʕ *L)c~#fo"kI*kI*L#)c~#foi*kI))_~#fo#ng!T! �k"_*L)c~#fo"mI*mI*Lg!T! �k"_*L)c~#fo"mI*mI*L#)c~#fo_*mI))_~#fo*__*mI#"mI%*mI*L#)c~#fo҉*mI*kI*LF4*kI#"kI*L#"Lü!��"mI!��"L*L|Ғ*L'�kOL%�n*mI�*L!,99*L'�kOL%�*mIs*L'�kOL$�n&�|5*mI*L'�kOL$�nѯg|k*L*L'�kOL$�n&�!,99*L'�kOL$�6�*mI*L'�kOL$�nѯg"mI*L#"Lé*mI+"mI|*mI*mIPn&�!Pm7*mI*mIPn&�!-99Ò! � n}ʿ!��"L*L|ҿ*L)c#)c~#fo5*mI))_##~#fo*_5*mI#"mI*mI*L#)c~#fo_*kI*mI*LF4*kI#"kIì*L)c~#fo*L#)c~#fo+ҕ *L)c~#fo"kI*kI*L#)c~#fo*kI*LH6|*kI#"kIÚ*kI*L#)c~#fo> *L)c~#fo"kI*kI*L#)c~#fo; *kI*LH6|1 *kI+"kI#*L/5*kI#"kIK *L!G.99*L)c~#fo*L#)c~#fo+ҕ *L)c~#fo#*L)c~#fo*LF4K *L#"L~!��"L*L|҄!*L'�kOLn}z!*L)c~#fo))_~#fo"_*_|:!*_##~#fo|)!*_�~#fo|~#fo*L#)c~#fo+C*L)c~#fo#*L)c~#fo*LF4*L)c~#fo*L#)c~#foҵ*L'�kOLn}µ*L'�kOL*La�s*L'�kOL#6�*L*La�!$-99*L#"L!��"L*L|x*L)c~#fo*L#)c~#fo!*L'�kOLn}!*L!I-99*L'�kOL6�*L'�kOLn}*L)c~#fo*L#)c~#foҜ*L!w-99*L)c~#fo*L#)c~#foҜ*L)c~#fo*L/5b*L'�kOL$�n}*L'�kOL$�n&�*L!-99n*L'�kOL͙9|8*L'�kOL| *#N͐a�+s*#N#6�- !*#NQ9!*#N �Q9!!K7|Y *#N�6n!!K7|t *#N�6m!!K7| *#N�6*#N�͐##s*#N �͐##s*#N$�6*#N%�͐s*#N&�6�!� ^#Vr+s ͐|͐'�kOL%�͐s!� ^#Vr+s M"#N!*#NQ9!*#N �Q9*#N�͐##s*#N �͐##s*#N$�6*#N&�6�!��!!)N͏A!��!�!P͏A!� w#w͐͐͐P͐##s!� ^#Vr+sÚQ!� s#r͐6�!� ~#fo(�s#r!͐Q9!� ~�"kI!�!c͐͒@�?�|*kI �kT*cs*kI �kT#*cs*kI �kT##*cs#r*kI �kT�*cs#r*kI �kT�*cs*kI �kT�6�*kI �kT�w#w*kI �kT �w#w!*99*kI#"kI!*99*.L&�|*.L&�|*.L&��|g}o|3*.L&�!*99>2.L*.L*kI�ʷ*kI*.L&�!+99*kI||!G+99͐͌A!�ͣ?*kI|ҙ*kI�|g}o|ʰ!z+99*kI�|g}o"kI*kI}2.L!� w#w!��"kI*kI*.Lѯg*kI!T! �k"_*_�n}!� ^#Vr#fo �s#r*J&�"mI!�͐!mI;A!� ~#fo##s#r*J&�"mI!�͐!mI;A!� ~#fo##s#r!�͐!J;A!�!-L͐�ͬA�?�!�?�?ҭ!99�{2c{2c!��"c!��"c>�2c!E�!!c͏A!� w#w͐*.Lѯgv͐͐͐}2c+͐͐&> 2c+>2c!�!c͐�ͬA�?�!�?`!99v!,99!� ^#Vr+s͐�͌A!/99!�9Invalid swap file size (%d), valid range is 16 to 248. �Invalid number of buffers (%d), valid range is 1 to 7. �+s*_##~#fo|%*_##~#fo|`*_!T! �͉*_##~#fo!+99*_##6#6*_�6*_�~#fo|ڌ*_�~#fo*_##~#fo*_!T! �͉*_�~#fo!+99*_�*_##~#fos#r*_�6*_n}/*_n&�|*_n&�|/*_!T! �͉*_n&�!+99*_6�*_�6*_#n}ʎ*_#n&�|Y*_#n&�|ڎ*_!T! �͉*_#n&�!",99*_#6�*_�6*_�n&�|ڰ*_�n&�|*_!T! �͉*_�n&�!R,99*_�6�*_�6*_n}r*_n&�++ �Creating a %d page swap file. �memo.swp�Can't create the swap file. �config.dat�a:config.dat�Can't open database file (config.dat), continuing. �justify�Database read error. �Database read error. �main�NAME.ME�fill�overwrite�justify�KILLS�KILLS�main� Swap file write error. � Swap file write error. �. � Completed. �!9DM!�!=*?!� s#rz҈!�!F*?!� s#rz҈!Q*99!�ͣ?! �!-L͐͒@�?�! �?!��!�͐G@|!h*99͐͌A!�ͣ?*-L}!*99!*99!�#z/W{/_!�9~#fo!� !� ! � ! � !� !� P!�9~#A!��9"w*�*w"j!z*"d!"f!Y"H>2^>2a>2`2c���2s2t>2r>2v!�"@!�"D!@�"B!�"F ���!�F#x�:~#!�|2i~# :" 2i +}|~#:G:ix."2i+w# +6�#!6�#@A2n2?*j**|+`!#"0�!#"2�!>ڌo&�͖=}  w~2���ͼ�56�!��+W ?_�!~7z?ͧ:>�͞@w#5 ~#fo##~#fo7|! !< ͐+++|l ! !� ~#fo##~#fo7|l !�!� ~#fo�~#fo8͹ ͐++++| ! !� ~#fo##~#fo7| !� ~#fo�~#fo8!� ~#fo�~#fo8͹ ! 99-all�-create�-create�Usage is: RECOVER {-create <size> {<buffs>}| -all} �!2 99!s 99RECOVER Version 1.1, Copyright (c) 1982 Chang Laboratories Inc. �RECOVER Version 1.1, Copyright (c) 1982 by Mark of the Unicorn, Inc. �!x9DM͐| ͐| ͐!99!�ͣ?͐| ͐.w�w#w#w#w*>?@͌>w#͌5> w#@ͧ͵g �2q&�0OxG͵j/ʆSx\͞.7:77!a{  ʨ ʨ0:?ŷO !y$� 7o&�))T])))!y �2p_ �:p� J� R� q!z z=naO $q$,�!;,�!Ù!;qz8O! !;,�z;qyO! ͣͣW_͕qyO! ͣ͒qy|! ͐!99!�ͣ?͐�|g}o}2.L*.L&�!�99!ͦ?`is#r͐�|h !(99!�ͣ?!��!E?!� s#rz !��!P?!� s#rz !]99!�"J>�2J>A2J!!KQ9a !��!�͐G@| !�!� ͐͒@�?| !99!H�!J!� ;A!�!� ͐͒@�?|E !99!�!J!� ;A͐͌A>2-L!��!�!0L͏A!� w#w͐͐ڹ *0L͐��|g}o}20L!� ^#Vr+sÀ !�� �!'�?!OL͏A!� w#w͐͐ ͐!OL!'�k"#N͐��������������,�����-�����.�����/�����0���0'��������� �������h�����h� �����$�����%�����&����`�O��`@# ���`@% ���`@' ����) ���� ���� ��� ���h����������������`�u ��`� ��`� ��`@�����������`@��� ����������������������������������h@����h@ ����`���`@�������h@�����h@����`������`���������������A������!��9DM ͐|!��< !� ~#fo##~#fo 7͐++|! ! !�Vr+s!|LQ͐͐!� n})Q!0�,Q! �!:Q!�9~#fo#|IQ!IRP͐n}ʐQ͐͐!� ^#Vr+sn&�!~Q!�9~#fo#|Q!IRLQ!� n}Q!� ^#Vr+s!|Q͐͐! �!Q!�9~#fo#|Q!IRÚQR!��IR͐͐`in&�!R!�9~#fo#|R!IR@R͐͐`in&�!1R!�9~#fo#|@R!IR×N!��IR!�9!��9DM!� n&�|ͯ}R!� n&�|ͩ!��9DM!� n&�|ͯڬR!� n&�|ͩ!9DM͐͐ R͐^#Vr+s͐R͐0�R͐7�s!�&�IS͐ ͐͐ ͉͐ͰR`is͐ ͐͐ )͐ͰR`in&�#&�IS!�9!9DM`iw#w͐~#fon&�9N}ʟS͐� �?͐^#Vr+snѯg`is#r`S͐�æS!�97,ҾS> 2h*P/:q2�> T:h):RS=S=> T:qw#w#w:ho&�552? #7:P,>3T2?!�^#V*R:T\T=MT\T*PKV*R!�s#r7:P)V> Uz> Uz2:P,"j!��"l*T|*l£T5*R�*j!�ѷT2?TT!ÞT*lÞT*T+"T*R�"R*l#"l*j!� N#Fp+qx“T#*��� ��b͸{�ECgw{ÖüH!K]jU �!^#V#*~#fo^#�*~#fo^#V#*n^#�*n^#V# ~#fo^#&� ~#fo!�+!��#!�+!��#!�+!�+��������}|z{|}|z7||7zZZ)|/g}/o#��|͉k|/g}/o#ɯ2hZZk:h|/g}/o#|/g}/o#:h<2hqDM!��xxGyO҃)v|͔`i|)Öx��ڷz/W{/_ѯzW{_=yOxGæ2hZZ͉M|}ȯ|g}o)|/g}/o#6>2?ØT2?7*T|DM*R*P@U><4U~# x4U ><PU~+ xPU|}7:P)"XV>Vz> Vz2:P,"j!��"l*T|¾U*j!�^#V*X#^#VҶUr+s*l5*R��"R*j"�*lU2?ùU#"l*T+"T*j!� N#Fp+qxU##6>2?öU2?7*�+++:PG_�*RDM!5Vo&�7:PO*R� ,\V>2?)~2#"j!!�~#fo#�^#Vp+q*j~#foҗVs#r5���������������������������������������������������������������������������������������������������3G`i~#fo!� ^#Vr+sn&�͐�͹Ks#rF8M͐�`is#r͐�|~G!�͜L! �͜L!�͜L*Y+"Y`i^#Vr+sFG! � ^#Vr+s6�͐ ÓG!�9!9DM`iw#w͐n}H͐n&�|G͐n&�|G!H<"͐�H͐� �k͐nѯg`is#r!� ^#Vr+sêG͐�H!�9Invalid decimal number.�!9DM`iw#w͐n}H͐n&�II}oH!H<"͐�H͐�))))͐n&�9N}ʗH͐n&�íH͐n&�ͽM&� �`is#r!� ^#Vr+sEH͐�H!�9Invalid hexadecimal number.�!9DM͐`is#L|6ML}M$M3ML6M*Y}͝}2Y6M6M*Y!��9DM͐!�:VA�s!mM͐#M:�!��9DM!I!� hN!��9DM!� n&�RR|ʰM!� n&�÷M!� n&�&�!��9DM!� n&�́R|M!� n&� �M!� n&�&�!9DM͐`is#r!� ^#Vr+s!� ^#Vr+sns{)NN͐�0N!�9!��9DM!� n&�|ͯdN!� n&�|ͩ!Y9DM!� ^#Vr+s~#fo!� s#r͐!� s#r!� ^#Vr+sn`is{CR`in}%R!� !� s#r!� 6#6�!� �s!� s!� s͐n}-N!� ^#Vr+s!� 4͐n}0r͐�n}(I͐�n&�II}(I`i^#Vr+sI͐�n}8I!��;I!&�@I!�9!��9DM!� n&�9N}ͣ–I!� n&�ͽM&�|ͯږI!� n&�ͽM&�|ͩ&�!��9DM͐n}I͐n&�9N}I!� ^#Vr+säI͐n}I!��I!&�!��9DM!� n&�J>�2Y!��"Y!�"Y!9DM!� n&�|QJ!� n&�|QJ*Y#"Y!� n&�͜LJ!� n} _JÖJ*Y��`is#r͐�|ʓJ! �J`i^#Vr+svJJ!� n&��|g}o|J!~�J!� n&��|g}oJJ!^�J!� n&�@�|g}oJJ!�9! �͜L! �O!� 4͐n&�9N}%O!� RS(O!��!� s#r!� ^#Vr+sn`is{.pO!� RS!� s#r!� 4!� ^#Vr+sn`is`in&�͉M}DʡOUOXOOOC5PSfP�QQ͐~#fo|O!� ^#Vr+s6-͐͐~#fos#r!� ^#Vr+s!� 6 O!� 6O!� 6!� ~#fo!� n&�!� ^#Vr+s~#fo!� ͰRѯgs#rP!� ^#Vr+s!� ^#Vr+s~#fos!� ^#Vr+sP!� n}yP!� 6#6�!� ^#Vr+s~#fo!� s#r͐n}P͐|P!� ^#Vr+s!� ^#Vr+sns!� ^#Vr+s!� ^#Vr+sÔP͐6�!� !� s#r!� n}LQ!� ^#͜L*Y#"Y*Y+K/K!��"Y*Y"YJ!9DM*Y!� s>�2Y!KpLL} YKMK! �͜L`i6#6�`i^#Vr+szʂK! �͜LhK! �͜L!� n}2Y!�9-- Hit RETURN to continue --�!9DM! � n&�|K! � n&�|K!�\L! � n} KL͐��`is#rUL! � n&��|g}o|KL! � n&��|g}o͐#͹K#`is#rRL`i6#6�UL͐�\L!�9!�͜L!��9DM͐n}ʚL!� ^#Vr+sn&�JxL!��9DM!� n&�!�VM*Y}L!� n&�!�V!9DM!��"Y!�V&�L!�9!�Vr+s~#fos#ræ<!=pL!,� ͐!�͟D}p=͐,+)!� ~#fo|p=͐,+)!� ~#fo!g=!�9~#fo!��&�x=!&�x=!.�9 %2d - %s�Enter the number of your selection, followed by a CR --> �!9DM! � `is#r͐�~#fo|@͐�~#fo>=>�O>>>>�s>>>>�ʗ>>>>�ʻ>>(>>�>>4>>�:?>@>>�ʟ?> L>>�??`i^#Vr+s~#fo�C|p>!&�@@`i^#Vr+s~#foC}ʔ>!&�@@`i^#Vr+s~#fo/D}ʸ>!&�@@`i^#Vr+s~#fo!!��͟D}>!&�@@`i^#Vr+s͐�####~#fo!9DML`is`in&�͉M`is`in}GCYMC MCNdCdCdC{CÊC!ÛC!CpLJ͐6!��ÛC!CpLJ͐6�!��ÛC*Y}͝}2YØCJ!CpLØCC!�9Yes�No�Enter 'Y' or 'N' --> �!9DM!�`i_E}C!&�D`iH}D͐`i7Hs!��&�D!DpLC!�9Enter a hex byte --> �!9DM!�`i_E}PD!&�ÀD`iH}uD͐ `i7Hs#r!��&�ÀD!DpL7D!�9Enter a hex byte --> �!9DM! �`i_E}D!&�0E`i͜I}D͐`i͜Gs#r`i͜I}E͐~#fo͐E͐͐�##~#fo͐�~#fo͟D}'?!&�@`i~#fo####s#r@`i^#Vr+s!� ͐�##~#fo͐�~#fo͟D}p?!&�@`i~#fo####s#r͐�~#fo!� s#r͐͐s@`i^#Vr+s͐�~#fo͐�##~#fo_E}?!&�@`i^#Vr+s@`i^#Vr+s~#fopL@J͐�~#fopL@`i^#Vr+s=!��&�@!�9!9DM!� 6!� w#w! � `is#r͐�~#fo|ʛB͐�~#fo> e@>�@>q@>�@>}@>�@>‰@>�9A>•@>�jA>¡@>�ʜA>­@>�A>¹@>��B>@>�1BNB`i^#Vr+s~#fo!� s#rÎBJ`i^#Vr+s~#fopLÎB!� ~#fo͐E!��&�0E͐͐!9EoMçD! �9Enter a number between %u and %u --> �!9DM8M`is#r͐[|چE![� 6P#6�!� !S� s#rL!R� s{ ʺF͐S!� ͐[+E!R� n}E!R� n}E!R� n}E͐S!� ͐�F!S� s#reL!R� n}$F/F/F_FnFnFÓFJ!&�F͐S!� \F͐S!� ͐�F!S� s#r÷F*Y}͝}2Y÷FL!R� n}͝†F!�ÉF!���!R� s!R� n&�J!S� ^#Vr+s!R� ns÷FÒE͐S6�!� ͐YMJ!��&�F!U�9!9DM͐`is#r͐͐ +6`i^#Vr+s~#fo!� s#r͐n}.A!BpL6A!BpLÎB!� 6`i^#Vr+s~#fo!� s#r͐n&�!BoMÎB!� 6`i^#Vr+s~#fo!� s#r͐~#fo!BoMÎB!� 6`i^#Vr+s~#fo!� s#r͐~#fo!BoMÎB!� 6`i^#Vr+s~#fo!� s#r͐~#fo!BoMÎB!� 6`i^#Vr+s~#fo!� s#r͐n&�!BoMÎB!� 6`i^#Vr+s~#fopLÎBJ!� n}yB!� ^#Vr+s!BoM!� 6�ÁB!BpL͐�~#fopL`i^#Vr+sD@͐âB! �9Yes�No�%xH�%xH�%u micas�%u�%d� %2d - � �!9DM`i�C|BB`in&�B!�9}2ZÍ4!��!Z!�!7!7=}13!��&�á4Í4!��!Z!�!7! 8!28!q8!8=!�9}k3!��&�á4Í4!��!Z!�!8!9!79!t9!9=!�9}ʥ3!��&�á4Í4!��!"Z!�!9!:=}3!��&�á4Í4!��!$Z!�!O:!r:=}3!��&�á4Í4!��!(Z!:!��!�!:!:!;=!�9}74!��&�á4Í4!��!� !�!�!<;!O;!;!;!;! <=!�9}z4!��&�á4!� n&�ͽM}2+ZÍ4`i^#Vr+sô0!&�á4!�9Line spacing in tenths: �spacing: 20>?�What is the default line spacing <single spacining? �of sectioning starting with the chapter command.�the section command while the full form provides four levels�simple form provides three levels of sectioning starting with�There are two styles of sectioning commands available. The�<1/6 inch: 423>? Height in micas: �How much vertical space would you like above each environment�<1/6 inch: 423>? Height in micas: �How much vertical space would you like below each environment�Amount of endspace in bytes: �table of contents and index information <1000 byteg: 10; double�<1/6 inch: 423>? Spacing in micas: �How much additional space would you like between paragraphs�<1/5 inch: 508 micas>? Indentation in micas: �How much should the first line of each paragraph be indented�Tab spacing: �such as Verbatim, that preserve whitespace. <usually 8>�Tab characters are only relevant within certain environments,�Tab stops are initially set at multiples of the tab spacing.�Do you want justification (even right margin)? �Type of foot notes (Bottom, End, Inline): �of refers>.�The endspace is the area reserved for storing endnotes,� Maybe, Always): �Print document automatically after formatting (Never,�("Maybe").�just go ahead and print it ("Always"), or can ask you first�can call FinalWord Print automatically to print it. FWP can�After the FinalWord Format program has formatted a document, it�!9DM!� w#wJJJJ!2� `is#r͐�~#fo|¦<`i^#Vr+s`i^#Vr+s~#fopLJo<͐�~#fo|=͐|=`i^#Vr+s~#fo͐#!=oMJ!� ^#Vr+s)!� `i^#Vence).�the end of the document, or inline (parenthesized at the point�The @foot command can place notes at the bottom of the page, at�Use superscripts for footnote numbers? �Footnote references can be printed as superscripts or bracketed.�Allow extra vertical space? �on devices that cannot half-linefeed.�extra space can be visually distracting. Space is always left�can run together unless extra space is left. However, such�Subscripts from one line and superscripts from the next line�Use four level sectionit after receiving certain commands before it displays menus�The message delay constant controls how long the editor will�Preferred cursor vertical percentage: �value is 50, but it can be adjusted to suit personal preference.�0 means the top of the screen, 100 means the bottom. The normal�whenever it adjusts the display. It is entered as a percentage:�far down from the top of the screen it should leave the cursor�The "preferred cursor vertical percentage" tells the editor how�Print files while editing? �rthe text�Printer highlighting mode: �no printer highlighting.�F2, or F3 (user-definable attributes). Enter R ("roman") for�all), I (italic), B (bold), P (bold italic), G ("greek"), or F1,�non-blank), UN (underscore letters and digits), UX (underscore�one of the following kinds of printer highlighting: U (underscore�text that is highlighted on the screen can be printed using any�!9DM͐#|£0`i6#6�!� 6 #6�ô0͐!� s#r`is#r͐�͐ڙ4͐�>0>�g1>0>�ʡ1>0>�1>0>�1>1>�un too sluggishly.�Also, you may find that printing while editing makes the editor�the printer, so if you need to do this, you should answer "no".�However, it cannot pause for the user to insert each page into�The editor can print one document while you edit another.�Top margin in micas: �the page heading <1/2 inch: 1270 micas>?�How much space would you like between the top of the page and�Bottom margin in micas: �bottom of the page <1/2 inch: 1270 micas>?�How much space would you like between the page foot~2>1>�ʽ2>1>�3>(1>�43> 41>�n3> @1>�ʨ3> L1>�3> X1>��4> d1>�:4Í4!��!Z!2�!�!�!4!4!4=!�9}ʞ1!��&�á4Í4!��!Z!�!5!35=}1!��&�á4Í4!��!Z!�!o5!5=}1!��&�á4Í4!��!Y!�!�!�!5!5!"6!`6=!�9}42!��&�á4!� 6#6�͐|{2͐)Y͐+)Y~#fo*Ys#r!� ^#Vr+s=2Í4!��!� !�!6=}ʣ2!��&�á4!� n}ʳ2!b�ö2!l�}2ZÍ4!��!� !�!�!6!6!7!F7=!�9}2!��&�á4!� n&�ͽMing and the�Left margin in micas: �and the text <1 inch: 2540 micas>?�How much space would you like between the left edge of the page�Right margin in micas: �edge of the page <1 inch: 2540 micas>?�How much space would you like between the text and the right�Heading space in micas: �beginning of the text <1/2 inch: 1270 micas>�How much space would you like between the page heading and the�Footing space in micas: �and the page footing <1/2 inch: 1270 micas>�How much space would you like between the bottom of Y!YUâ!�!Y!YUâ!!�!Y! ZUâ!�!Y!,ZUâ!�!Y!FZUâ!�!Y!ZUâ!�!Y!F[Uâ!�!Y!F\Uâ!��͐*YT|!�!Y*YbU�?|! <"͐| !�![*YbU�?| !* <"Data file write error.�Data file write error.�!9DM͐>Y >�t >e >�ʋ >q >�ʢ ù *Y`is#r*Y!� s#r *Y`is#r*Y!� s#r *Y`is#r*Y!� s#r !v!<"!m!!��͐�*YT| !!<">�2Y͐�͐M!!�!-=}%!��&�&ô&!��! Z!�!.!.!H.=}K%!��&�&ô&!��! Z!�!.!.!.=}|%!��&�&ô&!��!� !�!�! /!%/!>/!|/!/!/!>0!%%In the "direct print" (as opposed to Advanced Formatting) mode,�=!�9} &!��&�&!� ">U2*Z!� n}ID&BD&PD&GD&RD&UP&Fz&é&!� n}2*Zñ&!� n}Nc&Xc&o&!� n}2*Zw&>U2*Zw&ñ&!� n}1ʒ&2ʒ&3ʒ&Þ&!� n}2*Zæ&>U2*Zæ&ñ&>U2*Zñ&ô&`i^#Vr+sê"!&�&! �9Swapping delay constant: �results in a six seco!Y*YhT�?|!!!!<"*Y}A!! � ^#Vr+s!|A!M!`i^#Vr+s ͐�͐f!!��m!m!͐�m!!�9Invalid record type.�Data file seek error.�Data file read error.�!��9DM͐n&�ͽM!� ^#Vr+sn&�ͽM}!!��!� ^#Vr+sn}¿!!!��9DM͐n}:"͐͐n&�͉Ms!� ^#Vr+s"!��9DMJ!�͜L͐!j"oM!�͜L#KError: %s�!9DM͐#|™"`i6#6�!� 6 #6�ê"͐!� s#r`is#r͐�͐&͐�>">�E#>">�ʇ#>">�#>">�$>">�Y$>#nd delay on our system.�to swap automatically. We like a value around 300, which�will wait after the last keyboard activity before starting�The swapping delay constant controls how long the editor�Message delay constant: �the screen unless needed.�experience, you can increase it, so the menus don't clutter up�this number around 100, so the menus come up quickly; as you gain�you are a newcomer to this word processor you should probably set�and other messages describing what can follow those commands. If�wa>�ʊ$>#>�ʻ$>#>�$> *#>�%> 6#>�N%> B#>�%ô&!��!Y!!��!�!&!&!'!R'!'=!�9}ʄ#!��&�&ô&!��!Y!!��!�!'!'!'!8(!z(!(!(!=)=!�9}#!��&�&ô&!��!Y!d�!��!�!z)!)!)!#*!d*!*=!�9}$!��&�&ô&!��!Y!�!*!*!+!S+!+!+=!�9}V$!��&�&ô&!��!Z!�! ,!",!K,=}ʇ$!��&�&ô&!��! Z!�!,!,!,=}ʸ$!��&�&ô&!��!Z!�! -!#-!F-=}$!��&�&ô&!��!Z!�!-!-Z!�!!Y!�!#!Y!�!?!Y!�!f!Y!�!!!�!!�! !�$@!P�9`is#r͐�i!�9Highlighting mode: �Space between bottom of text and footing: �Space between heading and top of text: �Right margin: �Left margin: �Bottom of page margin: �Top of page margin: �Print files while editing? �Preferred cursor vertical percentage: �Message delay constant: �Swapping delay constant: �with Control-Z if you don't want to enter a new value.)�(Select any item for a fuller explanation; you Default Formatting Parameters�!9DM!� 6!� w#w*Y`is#r͐�*Yҿ͐�!�͚*FZ}ʳ!� n}rJÉ8M|҉! �Jr!� n}͝!� s!FZ!� ^#Vr+s!oM`i^#Vr+s=͐!�9 %2d. %s�!9DM!� 6!� w#w*Y`is#r͐�*Y}͐�!�͚*Z}q!� n}0JG8M|G! �J0!� n}͝!� s!Z!� ^#Vr+s!oM`i^#Vr+s͐Ä!�9 %2d. %s�!��9DM!��͐*YT|!�!Y*YhT�?|!><"͐>�>�V>>�k>can reply�Default Parameters Menu�!9DM*Z}b͝!� s*Z}iP!!� s#rw*Z}eg!!� s#rw>b2Z!!� s#r*+Z}nŽ!!� s#rõ*+Z}a¥!!� s#rõ>m2+Z!!� s#r!��͐!�!!(Z!�!!$Z!�!!"Z!�!5!Z!�!d!Z!�!!Z!�!͐!�!!� !�!!Y!�!!Z!�!*!Z!�!V!Z!�!q!!�!!�!�!�$@!\�9`is#r͐�Ç!�9Inline�End�Bottom�Never�Always�Maybe�Automatically print after formatting: �Amount of space to reserve for end d >�ʀ>>�ʕ>#>�ʪ>/>�ʿ>;>�>G>�>S>�'<!�!Y!YU<!T�!Y!YU<!�!Y!YU<!!�! Z!YU<!�!,Z!YU<!�!FZ!YU<!�!Z!YU<!�!F[!YU!�![*YhT�?|$!T<"<!�!F\!YU<Data file read error.�Data file read error.�!��9DM͐>�‚>�>Ž>�>š>�>¦>�$>²>�9>¾>�N>>�c>>�x>>�ʍâ!�!Y!YUâ!T�!ata: �Vertical space to leave below an environment: �Vertical space to leave above an environment: �Allow full four level sectioning? �Allow extra vertical space for super/sub scripts? �Use superscripts for footnote numbers? �Type of foot notes: �Justify right margin? �Tab spacing in characters: �Amount to indent first line of paragraphs: �Space between paragraphs: �Line spacing (in 1/10 line): �with Control-Z if you don't want to enter a new value.)�(Select any item for a fuller explanation; you can reply�nfiguration Program�Copyright (c) 1983 by Chang Laboratories, Inc.�� �� needs in order to operate.�that �enter various pieces of information about your computer system� Configuration program. It allows you to�This is the �CONFIG.DAT�CONFIG.DAT�Editing the configuration file "%s%s".�A:CONFIG.DAT�A:CONFIG.DAT�Editing the configuration file "%s".�Can't find the %s system configuration file,�A:CONFIG.DAT�CONFIG.DAT�as either "%s" or "%s".�Data base is version %d.%d;�This program requires %d.%d or ea͐+!�A "YJ!�9printer, for details.)�Predefined Printers, as well as the manual that came with your�with one that is; consult the Installation Guide section on�(Even if your printer is not on the list, it may be compatible�The following predefined printer types are available:��Currently selected printer type: %s�No printer type has been selected�you do not want to select a new one): �What is the number of your printer type (hit <Return> if�!9DM!�!�͚!�!�͚`is#r!��!� rlier.��type Z) to escape from the current section of the program.�You can at any time type Control-Z (hold down the CTRL key and��!��!��j!�!�j*YT!��! ! =J�Exiting Config.�!9DM!��!!!!0!p!=!�9`is#rJ*Y|9*Y!�͚*FZ}9!FZ!oMA!oM!��!� ͐�!��!�!!=!�9}qÓ͐|ڐ͐+!�A "YJ!�9terminal, for details.)�Predefined Terminals, as well as the manual that came with your�with one tha͐�!�!�!R=}#/͐t"!�!�j!�!�j!�9Field number to edit (or Control-Z): �!9DM!�!�͚"`is#r!��!� ͐�!�!�!=}͐~0Í>2&Z>�2'Z!�!�j!�9Field number to edit (or Control-Z): �!9DM**Z&�͉M}2*Z!� �s!� s**Z}IsBsPsGsRsUsNX1ʑ2ʑ3ʑã**Z!� sñ!� 6U**Z!� sñ!� 6F**Z!� sñ!� Us{2*Zñ!��!� !�!r! Z!�!! Z!�!!Z!�!!Z!�!! Z!�!!t is; consult the Installation Guide section on�(Even if your terminal is not on the list, it may be compatible�The following predefined terminal types are available:��Currently selected terminal type: %s�No terminal type has been selected�you do not want to select a new one): �What is the number of your terminal type (hit <Return> if�!9DM!��!!6!u!!!&=!�9`is#rJ*Y|ڼ*Y!�͚*Z}ʼ!Z!'oM!KoM!��!� ͐�!��!�!m!=!�9}͐|*��� ��b͸{�YVw{ÖüH!K]jU 2͵ ^#V#*~#fo^#�*~#fo^#V#*n^#�*n^#V# ~#fo^#&� ~#fo!�+!��#!�+!��#!�+!�+��������}|z{|}|z7||7zZZ)|/g}/o#��|͉k|/g}/o#ɯ2hZZk:h|/g}/o#|/g}/o#:h<2hqDM!��xxGyO҃)v|͔`i|)Öx��ڷz/W{/_ѯzW{_=yOxGæ2hZZ͉M|}ȯ|g}o)|/g}/o��������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������!$ "Y!2 "Y!: "YḮ !Y~#fo �n}Y QJ !��!S =B}#z/W{/_!�9~#fo!� !� ! � ! � !� !� P!�9~#A!��9"w*�*w"j!z*"d!"f!Y"H>2^>2a>2`2c>2s2t>2r>2v!�"@!�"D!@�"B!�"F ���!�F#x�:~#!�|2i~# :" 2i +}|~#:G:ix."2i+w# +6�#!6�#@A2n2?*j**|+`"d!"f!!>ڌo&�͖=}  w~2ʸͼ�56�!��+W ?_�!~7z?ͧ:>�͞@w#5 !Y~#fo�n}Y x̓ JMemoPlan� �MP� �Custom Term:N DocuPlan:N�Do you wish to see the default parameters menu? �!9DM*Y! oMJ! oM!��!Q !R ! �*Y! �!n !t ! ! �*Y! �! =!�9!�! ͯS"Y| `i@M! `i!� oMd !�!' ͯS"Y|7 !4 !A oMd *Y!f oMJ! ! ! oMJ!�T!��!��͚!�!�͚*Y}• *Y&�| *Y&�*Y&�! oMJ!�!�! oMJJ!�T>2Y#K!��! ! !C ! =!(�9%s Co.w�w#w#w#w*>?@͌>w#͌5> w#@ͧ͵g �2q&�0OxG͵j/ʆSx\͞.7:77!a{  ʨ ʨ0:?ŷO !y$� 7o&�))T])))!y �2p_ �:p���������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������"��. MERGE UTILITY FOR BBC BASIC ��. R.T.RUSSELL, 16-10-1982 ��: $�� A(1),B(1),C(1),F(1),L(1),A$(1) ��: �� �� "FILE 1",F1$ ��F(0)=(F1$) �� F(0)=0 "File not found" �� F(0)<>0 ��: �� �� "FILE 2",F2$ ��F(1)=(F2$) �� F(1)=0 "File not found" �� F(1)<>0 ��: �� "OUTPUT FILE",F3$ ��F3=(F3$) !�� F3=0 "Directory full" : ��: ��READ(0):READ(1) �� 7�� L(0)<L(1) WRITE(0):READ(0) WRITE(1):READ(1) �� #F(0) #F(1) �� #F3,0 ��#0 �� ��: $�� READ(F): #F(F) L(F)=65536: 4��A(F)=#F(F):B(F)=#F(F):C(F)=#F(F):#F(F),A$(F) ��L(F)=B(F)+256*C(F) �� ��: �� WRITE(F) ,��#F3,A(F):#F3,B(F):#F3,C(F):#F3,A$(F) �� �ot found" �� F(1)<>0 ��: �� "OUTPUT FILE",F3$ ��F3=(F3$) !�� F3=0 "Directory full" : ��: ��READ(0):READ(1) �� 7�� L(0)<L(1) WRITE(0):READ(0) WRITE(1):READ(1) �� #F(0) #F(1) �� #F3,0 ��#0 �� ��: $�� READ(F): #F(F) Lr H Abort command L Search for string M Search forward N Search backward P Prefix one Q Prefix two lESC <digit>: Enter repeat count t Do previous command again u Main menu O Undelete Close up the paragraph Next document Adjust paragraph Get help [Ctrl-X X R: Read file ]Ctrl-X X W: Write file Ctrl-X X C: Center line qCtrl-X P: Print file sCtrl-X P: Abort printing KCtrl-X X U: Update display ICtrl-X E: Exit (Quit) editor hCtrl-X G: Global replace gCtrl-X X L: Line count report iCtrl-X Q: Query replace fCtrl-X X P: Position report @Ctrl-X X C: Copy Region to marker BCtrl-X X D: Delete Region to marker DCtrl-X X G: Goto marker CCtrl-X X S: Set marker TCtrl-X R I: Set indent column UCtrl-X R L: Set line length Ctrl-X R S: Set tab stop Ctrl-X R C: Clear tab stop Ctrl-X R A: Clear all tabs Ctrl-X R R: Set regular tab stops eCtrl-X X E: Enlarge window 8Ctrl-X M: Scroll other window bCtrl-X O: One window mode dCtrl-X S: Switch window cCtrl-X T: Two window mode Ctrl-X X Q: Insert a quoted character into the text. Ctrl-X X: Additional command menu Ctrl-X R: Ruler menu Ctrl-X C: Clear document Ctrl-X X T: Toggle (switch) modes Ctrl-X X M: Turn top level menu on/off Ctrl-X U: Underline on/off Backup and save file ^ Save file  Explain key Help about 2 Fill paragraph 3 Justify paragraph Unjustify paragraph Remove help text Delete paragraph  (switch) modes Ctrl-X X M: Turn top level menu on/off Ctrl-X U: Underline on/off Backup and ruler menu clear document toggle mode toggle menu justify mode close up para next document adjust para internal disp menu help move forward page set variable tab clear tab clear all tabs set incremental tabs internal 14 internal 15 internal 16 internal 17 delete para de toggle menu justify mode close up para next document adjust para internal disp mebackup file internal 13 attribute shift not memoplan 34 move forward part screen move backward part screen sub menu �This key does not correspond to any defined command.  Set direction to Forward  Set direction to Reverse  Delete object forward  Delete object in reverse This character is inserted into the text. Insert a tab into the text.  Insert a space into the text.  Character object  Move forward character  Move backward character  Delete forward character  Delete backward character  Word object  Move forward word  Move backward word  Delete forward word Delete backward word  Rotate case of word  Line object Edge of line object ! Insert a new line into the text # Insert open line $ Move to next line % Move to previous line & Move to begining of line ' Move to end of line ) Delete line * Sentence object + Move forward senetence , Move backward sentence . Paragraph object / Move forward paragraph 0 Move backward paragraph 4 Move by screen 5 Move forward screen 6 Move backward screen 7 Move by 1/5 screen ; Buffer object < Move end buffer = Move beginning buffenot implemented move forward move backward delete forward delete backward expansion 1 expansion 2 not memoplan 1 not memoplan 2 not memoplan 3 not memoplan 4 not memoplan 5 insert self insert tab insert token break insert quoted char object move forward char move backward char delete forward char delete backward char not memoplan 6 word object move forward word move backward word delete forward word delete backward word uncase word expansion 3 expansion 4 expansion 5 expansion 20 expansion 21 one window two window switch window grow window report location report line count replace query replace not memoplan 15 not memoplan 16 argument self expansion 22 expansion 23 expansion 24 expansion 25 print file not memoplan 17 abort printing again menu menu not memoplan 18 not memoplan 19 not memoplan 20 not memoplan 21 not memoplan 22 not memoplan 23 not memoplan 24 not memoplan 25 not memoplan 26 explain key apropos remove vline object eline object insert new line not memoplan 7 insert open line move next line move previous line move beginning line move end line expansion 6 delete vline sent object move forward sent move backward sent expansion 8 para object move forward para move backward para expansion 9 fill para justify para move screen move forward screen move backward screen move part screen move other window expansion 10 expansion 11 buffer object move end buffer move beginning buhelp text expansion 26 not memoplan 27 expansion 27 expansion 28 not memoplan 28 center not memoplan 29 not memoplan 30 not memoplan 31 expansion 29 expansion 30 internal 1 internal 2 internal 3 internal 4 internal 5 internal 6 internal 7 internal 8 unjust para not memoplan 32 internal 9 internal 10 not memoplan 33 internal 11 internal 12 backup file internal 13 attribute shift not memoplan 34 move forward part screen move backward part screen sub menu ffer expansion 12 expansion 13 copy region expansion 14 delete region set marker move to marker expansion 15 expansion 16 expansion 17 abort exit editor not memoplan 8 refresh display move search move forward search move backward search undelete prefix one prefix two prefix special not memoplan 9 set indent set width not memoplan 10 not memoplan 11 not memoplan 12 not memoplan 13 not memoplan 14 read file find file write file save file expansion 19  �. Program to verify a disk �. (alternative to VERIFY) '�. by R.T.Russell, BBC, 13-10-1983. (�: 82� par 15,buffer 255:X%=par 256:Y%=par 256:A%=&7F <� 7: 0:osword=&FFF1 F�: 6P�''12)141"DISK VERIFIER"'12)141"DISK VERIFIER" 5Z� ''"Enter drive number (0-3):"drive:?par=drive (d� '"Enter number of tracks:"tracks =n�head=0:gap3=27:gap1=22:length=1:sectors=10:skew=sectors-3 x�: !� '"Verifying drive ";drive' � track=0 tracks-1 �@%=4: track;:@%=&90A �verify(track) � track �: � '"Verified."' � �; � verify(track) �par!1=buffer �par?5=3 �par?6=&5F par?7=track par?8=0 par?9=sectors+32*length " osword !, par?10 '"Verify error"': 6 @; ���ar�=����=��_O�*��������uffer�=������������er drive number (0-3):"drive:?par=drive (d� '"Enter number of tracks:"tracks =n�head=0:gap3=27:gap1=22:length=1:sectors=10:skew=sectors-3 x�: !� '"Verifying drive ";drive' � track=0 tracks-1 �@%=4: track;:@%=&90A �verify(track) � trac?!�*P͞p7*P!9/:q2 � 6C#6O#6M�5Km*R|amR!\�&sm!\�&*T|sm!T!l�&�!�9�~#foʣm> + n#~‘m##ÅmxLmm �FmEXECL: Command line overflow $!�pn!�1w#m*�:�1m*n!n!���a{ ���ѷ�PY����!��:noUn2n&�� !o xn �. &� 7*T|DM*R*Pڭn><n~# x¡n ><n~+ x½n|}#7:P,>n2?!�^#V*R:To=oo*P]q*R!�s#r7:P)"XV>oz> oz2:P,"j!��"l*T|yo*j!�^#V*X#^#Vqor+s*l5*R��"R*j"�*lʡo2?to#"l*T+"T*j!� N#Fp+qxKo##6>2?qo2?7:P)V>tpz>tpz2:P,"j!��"l*T|*l p5*R�*j!�ѷ=p2?7p7p!p*lp*T+"T*R�"R*l#"l*j!� N#Fp+qxo##6>2?p2?7*�+++:PG_�*RDM!po&�7,ҭp> 2h*P/:q2�> p:h):Rp=p=> p:qw#w#w:ho&�552?*�:�+**7:PO*R�  Bq �> _� �Qq�  ,nq>2?)~2#"j!!�~#fo#�^#Vp+q*j~#foҩqs#r5E�]qMOVCHAR�|MOVWORD��2VMOVCMND�$MOVVLINE�FMOVELINE�MOVBUFFE�VM!�>!�>!�>!�>*���������������������������������������������������qrrbrrfred fred ferd   y  n� �����#�(�-�2�7�<�A�F�K�P�U�Z�_�d�i�n�s�x�}��������(����X-�A�r+s~#fo!� s#r!� ^#Vr+s!|ڀc͐n}jc!� ^#Vr+sn}%gc͐n};jc͐n}:jc͐n}]jc(c͐n};}c!� w#wc͐n}•c!� ^#Vr+sPePe͐n}c!� ^#Vr+sn}%c͐n}]cÛc͐n}c!� ^#Vr+sPe!� ^#Vr+s~#fo!� s#rPe!� ^#Vr+s!|3d!� ^#Vr+sn}%0d͐n}(3ddPe͐͐)!� s#rPe͐"{Pe͐"{Pe!� ^#Vr+s~#fo͐ tfPe!� ^#Vr+s~#fo`is#r͐�n}d`i^#Vr+sn&�͐ ͹fÛdPe!� ^#Vr+s~#fo͐ ͹fPe͐~#fo͐|g}os#r|i͐�qqͧis#r͐�~#fo͐q�Ai!��mi͐�~#fo!� s#r͐�~#fo͐s#r͐mi!�9@�!��9DM͐!�qA�s!i͐#͜j:�!��9DM͐͐ͩi͐i͐!��9DM͐n}i!� ^#Vr+sn&�.qi!9DM͐`is#r͐n}'j!� ^#Vr+sj!� ^#Vr+s͐ns!� ^#Vr+sn}'j͐�Vj!�9!9DM`iw#w!� ^#Vr+sn}ʌj`i^#Vr+smj͐�Ój!�9!9DM͐`is#r!� ^#Vr+s!� ^#Vr+sns{jîj͐�j!�9!��9DM͐͐k͐Pe!� ^#Vr+sz$e!��͐ ͹fePe!� ^#Vr+szMe͐n&�͐ ͹f'ePeee͐n&�͐ ͹f!� ^#Vr+s}a!�9!9DM!� n&�|ڤe!� n&�|e!� n&��|g}o|e* }}e!�kf!� n} e ef!�kf*{͐*e}ѯg*{kf!� n&��|g}o|ef*h}}-f* }}-f!��0f!�`is#r͐�!� n&��|g}o͐͐�|ekfkf!�kf!�9!��9DM͐ҝf͐ �͉͐tf͐ �)0�͐͹f!��9DM͐|f!� n&�f!� n&�v]!��9DM͐##~#fo#͐~k͐!��9DM͐͐*k͐.k͐!9DM`iw#w!� ~#fo͐�n!� ~#fo͐�n}Œk!� ~#fo`i^#Vr+sn}‰k!��øk@k!� ~#fo͐�n!� ~#fo͐�nѯgWøk!�9!��9DM͐|k͐k͐!��9DM!� n&�l| l!� n&� �l!� n&�&�!��9DM!� n&�|ͯCl!� n&�|ͩ7*P!~l/:q2*R!l/~l�5!��> 2?+�" :1 R O*UR X* !\�/:q2�5!��> 2?+7*Pͳl:q2\��5m> 2#fo͝Jg͐##~#fo͐�~#fo͝Jg͐~#fo͐�~#fo͝!��9DM͐##~#fo͐�~#foڐg͐##͐�~#fos#rÞg͐##^#Vr+s!� ns!��9DM͐~#fo͐##~#fo͝!��9DM͐~#fo͐�~#foh͐͐�~#fos#rn&�h͐^#Vr+sn&�!9DM͐͐͞p`is#rz|h͐ |uh!� xi͐!� i!� ͐ ͜j͐�h!h!� ͜j͐!� i͐!� ͞p`is#rzh͐ |h!� ͐ ͜j͐�h!h!�9a:�!9DM!vi`is#r͐�~#fo*~n!��Y_*j}&�͝`&!^|ͩg|͝!^|ͩg|PY&=Y!^|g!9DM!��"{"{*k}}Y*{!� s#r!"{_*k}&�͝``iw#w͐�*d}ѯgY͐�{6�`i^#Vr+sÙY!��"{"{͐"{Y`!�9!��9DM*h}}Z!� n}Z!� n&�+*h}ѯg�}/o|/g"{#Z!"{!��9DM!� ͐!�aa!9DM*{*{{nѯgcZZ*{!� s#r!"{_*m}}ʌZ*m}&�͝`Z*{`is#r͐�*{{nѯgZ! �*{#"{&`i^#Vr+sÕZ*{{*{s͐"{!�9_*q}}ͣ[*r}}ͣDM! � n&�|"_! � n&�|?_! � n&��|g}o|E_* }}E_!�_! � n&�͐|e`is#r*e}͐*e}ѯg�!� s#r͐͐�ҿ_! � n} ¬_͐*{`is#rÿ_`i~#fo͐s#r͐�_!�9*{*e}ѯg_!��"{!`%H*{*{ `*{*{:`*{*g}ѯg*{*f}ѯg*n}&�͝`*{"{*{"{*{*{ʐ`*{�|g}o*{�|g}o*{�|g}o*{�|g}o*p}&�͝`*{"{Off Screen�!��9DM!� n}`!� !� n&�+t}!��aa!9DM*l}}a*{!� s#r!"{_*l}&�͝`͐" [*s}}ͣ&�!9DM͐͐k͐9[m]*{`is#r*{!� s#r*s}}[͐"{!��"{_͐|ͩҍ[͐͐͐+Ñ[͐͐|ͩ͐+*f}ѯg͐*f}ѯg*s}&�͝`!�"{"{͐|Z\͐!� s#r͐͐!� s#r͐͐!� s#r͐! � s#r͐͐͐! � s#r͐͐!� s#r͐!� s#r\͐͐!� s#r͐!� s#r͐!� s#r͐͐! � s#r͐͐͐! � s#r͐!� s#r*s}} ]͐"{!��"{_͐*r}&�͝`͐"{_͐*q{Xa*{`is#r*{!� s#r*{*d}ѯgJa*{{*e}sCZ*{#"{!��"{a͐�"{͐"{!�9!9DM͐!� s#r!� w#w͐n}se͐n}%Se!� w#w!� ^#Vr+sn}*a!� ^#Vr+s~#fo!� s#r!� ^#Vr+sXb͐n&��|g}o�un&��|g}o|Ob͐n&��|g}o�un&��|g}o|Lb͐ �?!� ^#Vr+snѯg!� s#raXb!� 6#6�͐n&�k}rʸb[b]ʘc;ʛc:ʛc(c)cg6dyMdxWdladuadsʂdcd^dze'e!� ^#Vr+s~#fo`is#r!� ^#Vr+s~#fo͐�͐ aaPe!� ^#V}&�͝`͐�"{͐"{͐ ͐ !{͐!{~n͐`is#r!� ^#Vr+s!|m]͐�{6�`i^#Vr+sB]!�9!9DM!� n&�|ڞ]!� n&�|ڻ]!� n&��|g}o|]* }}]_!� n&�*{#"{*{#"{*{{n*{�]*{{*{s^!� n} ^ K^V^*{*{*{`is#r͐�|H^! �v]`i^#Vr+s+^^!^%Z^!� n&��|g}o|ʿ^* }}ʿ^*{* }&�+�|g}o"{!� n&��|g}ov]*{* }&�+�|g}o"{^!^�v]!� n&�@�|g}ov]^!�9<NL>�*o}&�͝`!9�++"{*e}&�"{* }&�Y͐* w}/O!O2O!O!O%ZCZ!� n}2f{>�2b{!�9 -%u%%- %c%c%c �Delete� Trans� Upper� Lower� Set� Clear� Flip��Forward�Reverse�%s%s�!��9DM͐|O!w͐|OD1O,1|P͐!O!�9~#fo|P͐|P!�P!w&O͐|BP,1|:P͐!4P!�9~#fo|BP!�w!��9DM͐|]P!w͐|lPD1oP,1|©P͐!P!�9~#fo|©P͐|ʛP!�ÞP!w&]P͐|P,1|P͐!P!�9~#fo|P!�w! �=2!��9DM!� n}cQc�####`is!� n&��|g}o!� sQU!� n&��`is!� n&��|g}o!� s`in&�#V!� nѯg)~#fonU!�9!9DM!��!�!��!V#h"~|U!�!y*~o�?�!�?U!�!x*~o�?�!�?�V!Vi!��&�óV�!�?!w!x~n!��"~*~|fV*~)}!hs#rzfV*~}6�*~~*~s*~#"~V*~|҂V!Vi!��&�óV`i6#6�͐�|ҫV͐�V`i^#Vr+sÉV!&�óV!�9memo.ovl�Overlay file open error. �Insuficent memory. �!|9DM*~!QcQcQcQcQcQ$cQ%cQ cQ'cQ&cQ*cQ+cQ,cQ.cQ/cQ0cQ;cQ<cQ=cQhQ!!��*]{|}Q!��* }}ʗQ!�zp|—Q!*]{!]{Q!�!z*zo�?|Q!��"]{*zn!��Qz"]{*]{|�R*]{#"]{+n&�!�zp!! �53!��9DM!� ^#Vr+s6�*{"{!� n&�"{͐!VR%ZCZZ͐%s�!��9DM͐"o{*o{|ډR! �3&*o{+"o{hR! �53|ʡR!�w! �=2|ʹR!w!��9DM͐"o{*o{*{R! �3&*o{*{"o{R*o{YRň� n&�!}ͣ`is#r*~X*~!��!}ͣ`is#r*~UW*~+~n`is#6�!��!� n&�)))*~n|W!�͐�)}~#fo*~o�?�!�?W!�!� *~o�?|W!]Xi!�{n!� ͐�)}~#forX͐�}!� ns*~͐�!~ͣ!� s#r!|DX͐++++! ~! ~~n͐�}2 ~͐�)}~#foTX!�9Overlay read error. �!9DM͐+!� s#r͐ n}X͐ n}½X!� ~#fo! � ^#Vr+snѯgs#r!� ~#fo! � ^#Vr+snѯgs#r`is#r͐�~#fo͐s#rÇX!�9!��9DM͐!JͬO!��9DM͐!JDP!!JDP!��9DM͐͐n&��|g}o�un&��|g}o|ʋS͐n&��|g}o�vn&�ÐS͐ns{ʦS!� ^#Vr+sGS!��9DM!� n}SSS!!� n&�QL!9DM*wyn&�wn&�T`is#r*z!� s#6�͐�!T!�9~#fo*wyn}2z&*w+"w|T*z}tNT͐}2zzT*z&�ͨS|kT͐ͨS|zT*z}2z͐}2z!�9!9DM!� n&�wn&�T`is#r͐�͐͐ ͐ ͐!T! �9~#foT!�9!9DM!� n&��|g}o|*U!� n&� E>�2zE͐�##~#fo}2zS!#E!�9!9DM!� n}pE*}�*|?"o{*o{|pE'Y|fEÃG*o{+"o{SE!"{!��Y!��"{!��"{͐|ʺE͐!G%ZCZ!��j44!�"q{E!��"q{! � `is#r͐�~#fo|oF'Y|oF*q{"{!��"{CZ͐�~#fo!G%Z͐�##~#fo|PF`i^#Vr+s~#fo!G%Z͐�##~#fo|PF`i^#Vr+s~#fo!G%Z*q{#"q{+j44`i^#Vr+sE* }&�Y'Y|rG*e}&�+*q{!G%Z!��"o{*o{|F*o{)|~#fo|F*o{)|~#fo*e}ѯgF*o{)|~#fo*q{!G%Z*o{#"o{ÜF'Y|!G*un&��|g}oW1�|g}o�un&� �|g}o!9DMZ'Y|IKøK*|`is#r͐�|ʗK*}!� s#r͐|ʋK'Y|zKøKoQ!� ^#Vr+sfK`i^#Vr+sRK'Y|ªK |ʪK×K'Y|¸KoQêK!�9!��9DM͐͐̀A}K͐!��9DM͐͐n&��|g}o�un&��|g}o|4L͐n&��|g}o�vn&�9L͐ns{OL!� ^#Vr+sK!��9DM!� n}ʊLʊLʊLʊLʊL ʊL ʊL ʊLÏL!!��!9DM'Y|ʩLNO0`is#rD.!� s#r͐�qL͐�d�k͉͐`is#r0M͐�jM͐� �k͐ w*e}ѯg!G*w*q{!G%Z'Y|LG* w*e}ѯgLG* w+*q{!G%Z*q{j44*q{"{!��"{!� n}rG3K*q{*y{҃GG !�9%s�%5x%s�%30x%s�%55x%s�%*y%0x%(-%)%0x�%*y%*xT�%*y%*x<�%*y%*x>�!!JDP!!JͬO!��9DM!��Y*d}&�+"{!��"{CZ!� ͐!"H%ZZ%r�!9DM*{`is#r*{!� s#r!��Y*e}͐ _j�*d}&�+!H%Z*z&�v]!I%Z* }&�Y͐ ! I%Z^3K<Y!� s*z}ʹHàH*d}&�+"{*e}͐ _j�"{CZ͐�"{͐"{Z!�9%*y%*x�͉#͉`is#r0M`i~#fo͐d�͉#͉s#r*b{}vM*c{!.�vM*d{B�vM*e{͐��vM*g{*a{}M*d}&�++"{*_{"{* }&�Y*a{}ʞM!U�áM! �B|ʰM!+�óM! �!.|M!*�M! �͐�!WO%Z!.}2c{B}2d{͐�}2e{*a{}2g{'Y|MNO*z}.N.NBNVNjN ~N ʒN ʦNúN!hO!� s#r!� 6N!oO!� s#r!� 6N!vO!� s#r!� 6N!}O!� s#r!� 6N!O!� s#r!� 6N!O!� s#r!� 6N!O!� s#r!� 6N!O!� s#r!� 6�N* w}N!� n&��s*b{}N!� n*f{}IO*d}&� to clear: �%s�!9DM͐XG*{!S� s`i!Q� s#r3K<Y!P� s!Z� n}MJ!P� n*z}dI8A!��×J͐Q`i͐^+ڴI!P� n}ʴI!P� n}ʴI!S� n&�͐Q`iR!Q� s#r^!P� n}II �JJ&J͐Q`iI!S� n&�͐Q`iR!Q� s#rJJ! �v]!Q� ^#Vr+s6 JJ3K<Y!P� s!P� n&�v]!Q� ^#Vr+s!P� nsJJ4I͐Q`iqJ͐Q6�`i͐\͜jJ͐\!J%Z*d}&�+"{!��"{Z!×J!T�9%s�W1�|g}o�un&�@�|g}oK|ͣJW1|͝W1|͝W1�|g}o�';*"�n*:~};;*�6;*n*"~}h;*##~#fo*$~h;*͐�h;*�"*;*"͐�kڑ;*�6͐ |;*͐�k;*n*"~};*##~#fo*$~;*"�6Ú;!�9!��9DM͐!� ns͐#!� ns͐##͐ s#r!��9DM*~&�~n͐��]<*~g�}2~*~&�~͐#�s*~&�)~~#fo!��9DM͐"$~**~͐"(~*,~<*(~*.~*,~"(~!9DM͐ !� n&�͐ͣ`is#r!� n&��|g}o�u^2@8A͐A!�9%r�!��!JDP!��!JͬO!9DM*{`is#r*{!� s#r*d}&�+"{!��"{CZ͐�"{͐"{Z!�9!9DM-"u{!AͦB|¿Aͥ03`is#ry0͐�͐�6͐|Aͥ0Ay0*u{ͦ!A͐(&�A!�9KILLS�KILLS�!��9DM!� n}:B:B(:B):B-:BB:B@:Bj:B?B!!��!9DM*} �*|?"o{*o{|ʃB'Y|yB!��÷B*o{+"o{cB*{`is#r*{!� s#r͐G͐�"{͐"{Z!÷B!�9*z&�B|ͣNC*z&�B|ͣB*z&�ͨS|ͣNC*z&�͋Cn&��|g}o|y=͐ !� n&��|g}o�un&��|g}o|U=!� n&��|g}o�vn&�Z=!� n&�͐ͣ͐� k`is#r!� n&��|g}o|^>* }}^>͐ !� n&��|g}o͐ͣ͐� k`is#r!� n&��|g}o�un&��|g}o|^>͐ !� n&��|g}o�un&��|g}o|1>!� n&��|g}o�vn&�6>!� n&��|g}o͐ͣ͐� k`is#r͐�e>!�9!9DM͐ !� n&�͐`is#r!� n&��|g}o�un&��|g}o|!?͐ !� n&��|g}o�un&��|g}o|>!� n&��|g}o�vn&�?!�|ͣC*z&�P|ͣNC*z&�͋C|ͣNC*z&�P|ͣNC*z&�ͨS|ͣ!9DM3`is#r!!KͬO͐�͐�6!�9!��9DM!� n}ʦCʦCëC!!��!9DM3`is#r͐!C!�9~#fo&*w+"w|C>2 w*w}C*z&�D*z!� �s#rQL|$D͐�͐̓T͐�6>�2 w!�9!9DM<Y"w*w�|g}o�un&��|g}o|ʀD*w�|g}o�vn&�ÃD*w"w*w|ҜD*w@�"w*w|´D!��"w!��#E!� `is#r͐�~#fo|D͐�~#fo*wD`i~#fo####s#rþD!�"w͐�~#fo| n&�͐͐�j`is#r!� n&��|g}o|@* }}@͐ !� n&��|g}o͐͐�j`is#r!� n&��|g}o�un&��|g}o|@͐ !� n&��|g}o�un&��|g}o|?!� n&��|g}o�vn&�?!� n&��|g}o͐͐�j`is#r͐� @!�9!9DM! � ͐!AG3K<Y`is{ ͝ʉ@`in&��|g}o�un&��|g}o|ʀ@`in&��|g}o�vn&�Ã@`in}Y͝!� s#rzʙ@A`in*z}@`in}@`in}@`in&��|g}o�un&��|g}o|@`in&��|g}o�vn&�@`in}N@A